Property Summary

NCBI Gene PubMed Count 22
PubMed Score 12.06
PubTator Score 12.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
gastric cancer 1.500 8.8e-03
hepatocellular carcinoma 1.200 2.6e-04
pancreatic cancer 1.700 2.6e-03
medulloblastoma, large-cell -1.200 1.8e-04
juvenile dermatomyositis 1.051 4.1e-08
non-small cell lung cancer -1.040 1.3e-10
pancreatic carcinoma 1.700 2.6e-03
subependymal giant cell astrocytoma 1.913 2.9e-02
progressive supranuclear palsy -1.500 2.3e-02
acute myeloid leukemia -1.300 1.4e-02
ovarian cancer -3.000 3.1e-05

Gene RIF (10)

PMID Text
23221025 Our results suggest that LYPLAL1 rs4846567 and NISCH rs6784615 may influence fat distribution in the Japanese population.
22179955 Gene-treatment interactions were observed for short-term weight loss. (LYPLAL1 rs2605100, Plifestyle*SNP = 0.032)
22052940 LYPLAL1 exhibits neither phospholipase nor triacylglycerol lipase activity, but rather accepts short-chain substrates
21953277 genetic association studies in Danish population: Quantitative metabolic phenotypes in obesity are associated with SNP in various genes: LYPLAL1 (rs4846567) is associated with waist-hip ratio and insulin sensitivity in women.
21674055 central obesity-associated variants in LYPLAL1, NRXN3, MSRA, and TFAP2B
20935629 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20724581 Observational study of gene-disease association. (HuGE Navigator)
20703240 Observational study of gene-disease association. (HuGE Navigator)
19557161 TFAP2B, LYPLAL1 and MSRA are associated with adiposity and fat distribution.
19557161 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MAAASGSVLQRCIVSPAGRHSASLIFLHGSGDSGQGLRMWIKQVLNQDLTFQHIKIIYPTAPPRSYTPMK      1 - 70
GGISNVWFDRFKITNDCPEHLESIDVMCQVLTDLIDEEVKSGIKKNRILIGGFSMGGCMAIHLAYRNHQD     71 - 140
VAGVFALSSFLNKASAVYQALQKSNGVLPELFQCHGTADELVLHSWAEETNSMLKSLGVTTKFHSFPNVY    141 - 210
HELSKTELDILKLWILTKLPGEMEKQK                                               211 - 237
//

Text Mined References (29)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24509480 2014 Genome-wide trans-ancestry meta-analysis provides insight into the genetic architecture of type 2 diabetes susceptibility.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23754948 2013 Sex-stratified genome-wide association studies including 270,000 individuals show sexual dimorphism in genetic loci for anthropometric traits.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23221025 2013 Replication study of 15 recently published Loci for body fat distribution in the Japanese population.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
22581228 2012 A genome-wide approach accounting for body mass index identifies genetic variants influencing fasting glycemic traits and insulin resistance.
22479202 2012 Novel loci for adiponectin levels and their influence on type 2 diabetes and metabolic traits: a multi-ethnic meta-analysis of 45,891 individuals.
22399288 2012 Distinct acyl protein transferases and thioesterases control surface expression of calcium-activated potassium channels.
22179955 2012 Genetic predictors of weight loss and weight regain after intensive lifestyle modification, metformin treatment, or standard care in the Diabetes Prevention Program.
22052940 2012 Crystal structure of the predicted phospholipase LYPLAL1 reveals unexpected functional plasticity despite close relationship to acyl protein thioesterases.
21953277 2012 Association studies of novel obesity-related gene variants with quantitative metabolic phenotypes in a population-based sample of 6,039 Danish individuals.
21674055 2011 Implications of central obesity-related variants in LYPLAL1, NRXN3, MSRA, and TFAP2B on quantitative metabolic traits in adult Danes.
21269460 2011 Initial characterization of the human central proteome.
20935629 2010 Meta-analysis identifies 13 new loci associated with waist-hip ratio and reveals sexual dimorphism in the genetic basis of fat distribution.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
20724581 2010 Genetic susceptibility to obesity and related traits in childhood and adolescence: influence of loci identified by genome-wide association studies.
20703240 2010 Polymorphisms in NRXN3, TFAP2B, MSRA, LYPLAL1, FTO and MC4R and their effect on visceral fat area in the Japanese population.
19557161 2009 Genome-wide association scan meta-analysis identifies three Loci influencing adiposity and fat distribution.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12706107 2003 Molecular characterization of a familial translocation implicates disruption of HDAC9 and possible position effect on TGFbeta2 in the pathogenesis of Peters' anomaly.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.