Property Summary

NCBI Gene PubMed Count 12
PubMed Score 10.43
PubTator Score 15.97

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Familial combined hyperlipidemia 3 3.012 1.5

Expression

Gene RIF (4)

AA Sequence

MCGNTMSVPLLTDAATVSGAERETAAVIFLHGLGDTGHSWADALSTIRLPHVKYICPHAPRIPVTLNMKM      1 - 70
VMPSWFDLMGLSPDAPEDEAGIKKAAENIKALIEHEMKNGIPANRIVLGGFSQGGALSLYTALTCPHPLA     71 - 140
GIVALSCWLPLHRAFPQAANGSAKDLAILQCHGELDPMVPVRFGALTAEKLRSVVTPARVQFKTYPGVMH    141 - 210
SSCPQEMAAVKEFLEKLLPPV                                                     211 - 231
//

Text Mined References (14)

PMID Year Title