Property Summary

NCBI Gene PubMed Count 12
PubMed Score 0.18
PubTator Score 5.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 1.6e-21
Disease Target Count Z-score Confidence
Mal de Meleda 7 4.926 2.5

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.100 1.6e-21

Gene RIF (4)

AA Sequence

MAMGVPRVILLCLFGAALCLTGSQALQCYSFEHTYFGPFDLRAMKLPSISCPHECFEAILSLDTGYRAPV      1 - 70
TLVRKGCWTGPPAGQTQSNADALPPDYSVVRGCTTDKCNAHLMTHDALPNLSQAPDPPTLSGAECYACIG     71 - 140
VHQDDCAIGRSRRVQCHQDQTACFQGNGRMTVGNFSVPVYIRTCHRPSCTTEGTTSPWTAIDLQGSCCEG    141 - 210
YLCNRKSMTQPFTSASATTPPRALQVLALLLPVLLLVGLSA                                 211 - 251
//

Text Mined References (12)

PMID Year Title