Property Summary

Ligand Count 63
NCBI Gene PubMed Count 311
PubMed Score 683.18
PubTator Score 437.41

Knowledge Summary

Patent (59,678)

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
HIV Infections 102 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Cancer 2499 4.71 2.4

Expression

  Differential Expression (35)

Disease log2 FC p
active Crohn's disease 1.978 1.4e-03
active ulcerative colitis 2.214 1.7e-03
astrocytoma 2.100 1.8e-02
Barrett's esophagus 1.900 1.2e-02
Breast cancer 1.100 1.0e-02
Chronic Lymphocytic Leukemia 1.110 4.6e-02
colon cancer 1.100 2.0e-02
cutaneous lupus erythematosus 1.600 5.4e-03
cystic fibrosis 1.377 1.2e-03
dermatomyositis 1.500 1.6e-02
diabetes mellitus -1.600 2.3e-02
esophageal adenocarcinoma 1.700 2.8e-02
facioscapulohumeral dystrophy -1.100 4.4e-02
gastric carcinoma 1.400 4.6e-02
glioblastoma 2.600 2.7e-05
group 3 medulloblastoma -1.400 4.6e-03
interstitial cystitis 1.800 4.8e-04
intraductal papillary-mucinous carcinoma... 1.500 4.7e-03
intraductal papillary-mucinous neoplasm ... 2.300 1.4e-03
juvenile dermatomyositis 1.098 1.3e-06
lung cancer -2.100 4.0e-04
lung carcinoma -2.900 8.9e-26
medulloblastoma, large-cell -2.400 8.2e-06
Multiple myeloma 1.644 4.4e-03
nephrosclerosis 1.055 4.3e-04
osteosarcoma -2.337 7.6e-04
ovarian cancer 2.400 4.8e-07
pancreatic cancer 1.100 9.6e-03
pediatric high grade glioma 1.100 6.8e-04
periodontitis 1.100 1.6e-28
Pick disease 1.500 9.1e-03
primary Sjogren syndrome 1.700 3.1e-05
psoriasis 1.700 1.8e-08
subependymal giant cell astrocytoma 1.428 4.7e-02
Waldenstrons macroglobulinemia 1.299 2.1e-02

Protein-protein Interaction (1)

Gene RIF (129)

AA Sequence

MGCIKSKGKDSLSDDGVDLKTQPVRNTERTIYVRDPTSNKQQRPVPESQLLPGQRFQTKDPEEQGDIVVA      1 - 70
LYPYDGIHPDDLSFKKGEKMKVLEEHGEWWKAKSLLTKKEGFIPSNYVAKLNTLETEEWFFKDITRKDAE     71 - 140
RQLLAPGNSAGAFLIRESETLKGSFSLSVRDFDPVHGDVIKHYKIRSLDNGGYYISPRITFPCISDMIKH    141 - 210
YQKQADGLCRRLEKACISPKPQKPWDKDAWEIPRESIKLVKRLGAGQFGEVWMGYYNNSTKVAVKTLKPG    211 - 280
TMSVQAFLEEANLMKTLQHDKLVRLYAVVTREEPIYIITEYMAKGSLLDFLKSDEGGKVLLPKLIDFSAQ    281 - 350
IAEGMAYIERKNYIHRDLRAANVLVSESLMCKIADFGLARVIEDNEYTAREGAKFPIKWTAPEAINFGCF    351 - 420
TIKSDVWSFGILLYEIVTYGKIPYPGRTNADVMTALSQGYRMPRVENCPDELYDIMKMCWKEKAEERPTF    421 - 490
DYLQSVLDDFYTATEGQYQQQP                                                    491 - 512
//

Text Mined References (343)

PMID Year Title