Property Summary

NCBI Gene PubMed Count 302
PubMed Score 659.29
PubTator Score 437.41

Knowledge Summary

Patent (59,678)

TINX Plot

  Disease (5)

Disease Target Count
HIV Infections 99
Disease Target Count Z-score Confidence
Cancer 2346 4.709 2.4

Expression

  Differential Expression (35)

Disease log2 FC p
nephrosclerosis 1.055 4.3e-04
Waldenstrons macroglobulinemia 1.299 2.1e-02
chronic lymphocytic leukemia 1.110 4.6e-02
Multiple myeloma 1.664 1.1e-02
Barrett's esophagus 2.100 7.2e-03
esophageal adenocarcinoma 2.000 2.1e-02
psoriasis 2.400 1.6e-04
cutaneous lupus erythematosus 1.600 5.4e-03
glioblastoma 2.600 2.7e-05
osteosarcoma -2.337 7.6e-04
group 3 medulloblastoma -1.700 2.9e-04
cystic fibrosis 1.377 1.2e-03
astrocytoma 2.400 4.4e-03
periodontitis 1.100 1.6e-28
medulloblastoma, large-cell -2.400 8.2e-06
juvenile dermatomyositis 1.338 5.8e-07
intraductal papillary-mucinous carcinoma... 1.500 4.7e-03
intraductal papillary-mucinous neoplasm ... 2.300 1.4e-03
lung cancer -3.300 3.3e-06
colon cancer 1.100 2.0e-02
active Crohn's disease 1.978 1.4e-03
active ulcerative colitis 2.214 1.7e-03
diabetes mellitus -1.600 2.3e-02
interstitial cystitis 1.800 4.8e-04
pediatric high grade glioma 1.100 6.8e-04
primary Sjogren syndrome 1.700 3.1e-05
subependymal giant cell astrocytoma 1.428 4.7e-02
Breast cancer -1.900 5.0e-07
lung carcinoma -2.900 8.9e-26
Pick disease 1.500 9.1e-03
gastric carcinoma 1.400 4.6e-02
ovarian cancer 2.700 4.3e-08
pancreatic cancer 1.100 9.6e-03
dermatomyositis 2.200 1.5e-03
facioscapulohumeral dystrophy -1.100 4.4e-02

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (122)

PMID Text
26708841 Authors discovered in this study that LYN was a critical gene. It was found to be the key nodule of several significant biological networks.
26517678 Inhibition of Lyn activity using dasatinib in mantle cell lymphoma overcomes bortezomib resistance.
26460485 SRC, LYN and CKB expression or DNA methylation could be useful markers for predicting tumor progression.
26308013 This study showed an interdependence between ROS generation and lipid rafts and Lyn relocation leading the cells to undergo the successive acrosome reaction.
26055819 positively regulates NF-kappaB transactivation through the phosphorylation of the p110 subunit of PI 3-kinase
25967238 Fyn, but not Lyn, was required for complete Pyk2 phosphorylation by thrombin.
25965880 Demonstrate role for CBL in the control of AXL/SYK/LYN network mediating resistance to nilotinib treatment in chronic myeloid leukemia cells.
25823815 Diminished Lyn levels impair Claudin-2 expression in breast cancer cells. The Lyn-selective kinase inhibitor, Bafetinib (INNO-406), reduces Claudin-2 expression and suppresses breast cancer liver metastasis.
25817574 Suggest an interrelated kinase module involving c-Raf/PI3K/Lyn and perhaps Fgr functions in a nontraditional way during retinoic acid-induced maturation or during rescue of RA induction therapy using inhibitor co-treatment in RA-resistant leukemia cells.
25418321 interaction between LacCer and Lyn in the lipid rafts of neutrophil-like cells
25401474 These results suggest that LYN mutations mediate escape from antiestrogens in a subset of ER(+) breast cancers.
25173936 Lyn tyrosine kinase promotes silencing of ATM-dependent checkpoint signaling during recovery from DNA double-strand breaks.
25104351 Cell detachment-induced Lyn activation through the change in the membrane distribution of Lyn plays an important role in survival of suspension cells.
24686085 Lyn kinase activity is important for CD38-associated signaling that may drive all-trans retinoic acid-induced differentiation.
24469048 molecular or pharmacologic inhibition of the Lyn-PI3K/AKT pathway, markedly increased the sensitivity of the otherwise chemoresistant Cbl mutant-JMML cells to chemotherapeutic agents currently used in the treatment of JMML patients
24407241 PSTPIP2 dysregulation contributes to aberrant terminal differentiation in GATA-1-deficient megakaryocytes by activating LYN.
24217950 An EphA4-Lyn pathway was identified that is essential for the metabolism of amyloid precursor protein.
24108461 in contrast to c-Src and Yes, which increase vascular permeability in response to stimuli, Lyn stabilizes endothelial junctions through phosphorylation of FAK.
24091144 Our data suggest that the LYN/PTEN expression ratio may be a sensitive monitor of disease progression in unmutated CML patients under imatinib or nilotinib treatment.
23975833 Lyn gene expression levels increase with primary glioma tumor grade and inversely correlate with patient survival. TWEAK protein promotes glioblastoma cell chemotaxis via Lyn activation.
23949219 MBNL142-43 bind the Src-homology 3 domain of Src family kinases (SFKs) via their proline-rich motifs.
23918783 These data demonstrate a mechanism whereby Fyn and Lyn, redundantly mediate anticryptococcal killing by inducing the polarization of perforin-containing granules to the NK cell-cryptococcal synapse.
23896410 Data indicate that combined treatment using SFK (LYN, HCK, or FGR) and c-KIT inhibitor dasatinib dasatinib and chemotherapy provides a novel approach to increasing p53 activity and enhancing targeting of acute myeloid leukemia (AML) stem cells.
23866081 Lyn, a Src family kinase, regulates activation of epidermal growth factor receptors in lung adenocarcinoma cells.
23696637 CBL linker region and RING finger mutations lead to enhanced granulocyte-macrophage colony-stimulating factor (GM-CSF) signaling via elevated levels of JAK2 and LYN.
23583449 these data suggest a novel role for Lyn in erythroid cell survival.
23450709 These results reveal that elevated expression of miR-30a is responsible for the reduction in levels of Lyn in B cells from patients with systemic lupus erythematosus, suggesting that miR-30a plays an important role in B cell hyperactivity.
23396948 The E613R allele of CD45 produces neither a pure hypomorphic nor a hypermorphic variant of the phosphatase; rather, it appears to alter CD45 substrate selectivity for specific Src-family kinases.
23378338 results define a novel signaling pathway in basal breast cancer involving Lyn and SgK269 that offers clinical opportunities for therapeutic intervention
23223229 The Dok-3/Grb2 protein signal module attenuates Lyn kinase-dependent activation of Syk kinase in B cell antigen receptor microclusters
23039362 Associations between treatment response and Lyn, Syk, PLCgamma2 and ERK were not found.
22895079 Oridonin inhibiting activations of LYN (one of SRC family kinases) and ABL and their downstream Akt/mTOR, Raf/MEK/ERK and STAT5 pathways.
22845063 The interaction between Lyn and FcepsilonRIbeta is indispensable for FcepsilonRI-mediated human mast cell activation.
22731636 Lyn is involved in CD24-induced ERK1/2 activation in colorectal cancer.
22490227 findings show that Lyn mediates tumor progression of EGFRvIII-expressing head and neck squamous cell carcinomas
22430206 our findings demonstrate that Yes and Lyn phosphorylate EGFR at Y1101, which influences EGFR nuclear translocation in this model of cetuximab resistance.
22393415 the activation of Hck, Lyn and c-Src by Nef is highly conserved among all major clades of HIV-1
22393415 The primary M-group HIV-1 Nef proteins (from A, B, C, F, G, H, J, and K subtypes) strongly activate LYN in cells
22246800 The role of the Src family kinase Lyn in the immunomodulatory activities of cathelicidin peptide LL-37 on monocytic cells
21978158 Lyn kinase blockage down-regulates TLR9-induced cytokines, but up-regulates non-canonical TLR3-induced cytokines in THP1 cells exposed to cytomegalovirus.
21951684 In chorea acanthocytosis red blood cells, band 3 Tyr phosphorylation by Lyn was independent of the canonical Syk-mediated pathway.
21918188 Lyn is a likely candidate to be the kinase required for myeloid differentiation factor-2 tyrosine phosphorylation following exposure to lipopolysaccharide
21749309 Data show that a higher percentage of classical Hodgkin lymphoma cases expressing Lyn, Fyn and Syk compared with previous reports.
21730355 an oncogenic signaling mediated by Lyn and Syk can bypass the need of Bcr-Abl in CML cells
21628423 describe a Lyn-dependent mechanism for promoting localized integrin activation and establishing adhesion sites at the leading edge to allow neutrophils to move forward in the chemoattractant gradient.
21513978 PTPIP51 is phosphorylated by Lyn and c-Src kinases lacking dephosphorylation by PTP1B in acute myeloid leukemia.
21345943 Lyn coimmunoprecipitates with the interleukin-2 beta receptor and JAK3 proteins in human T-cell leukemia virus type 1-infected T-cells.
21106848 Lyn contributes to the upregulation of the Ras-ERK-MAP kinase 1/2 and phosphatidylinositol 3-kinase-Akt cascades, as well as the increased leukotriene C4 release observed in response to formylated tripeptide F-Met-Leu-Phe (fMLP) in primed eosinophils.
20962850 Observational study of gene-disease association. (HuGE Navigator)
20693279 Lyn-dependent regulation of miR181 is a novel mechanism of regulating Mcl-1 expression and cell survival.
20679348 ADAM17-mediated activation of Lyn/Akt maintains the viability of U937 cells and that suppression of the pathway is responsible for PILP-1-induced apoptosis.
20605918 Results suggest that initiation of Golgi export of Lyn involves association of ACSL3 with the Lyn C-lobe, which is exposed to the molecular surface in an open conformation.
20561033 In the membrane environment of ALK+ lymphoma rafts, where the glycosphingolipid to signaling protein ratio is higher than in B-NHL rafts, the Lyn activity is suboptimal and does not allow the formation of an efficient Lyn-Cbp/PAG signalosome
20546612 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20215510 Findings define a prognostically relevant EMT signature in breast cancer and identify LYN as a mediator of invasion/
20189992 Lyn stimulates platelet secretion by activating the phosphoinositide 3-kinase-Akt-nitric oxide (NO)-cyclic GMP pathway and also provide an explanation why Lyn can both stimulate and inhibit platelet activation
20079716 the activation of the Lyn-phosphatidylinositol (PI) 3-kinase-Akt cascade suppressed the expression of a tumor-suppressor and pro-apoptotic protein, p53, and supported the survival and proliferation of myeloma cells.
20056178 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19965664 Data show that RTX treatment results in a time-dependent inhibition of the BCR-signaling cascade involving Lyn, Syk, PLC gamma 2, Akt, and ERK, and calcium mobilization.
19893451 Study identified the previously reported pathogenic mutation of NTRK3 in a KRAS/BRAF wild-type tumor and 2 somatic mutations in the Src family of kinases (YES1 and LYN) that would be expected to cause structural changes.
19710703 Identification of a novel TEL-Lyn fusion gene in primary myelofibrosis.
19641380 Four genes, PCSK1, (P=0.008), EGFR,(P=0.003), PAX4,(P=0.008), and LYN,(P=0.002) consistently yielded statistical evidence for association with longevity.
19619611 Results provide a novel role of the Lyn catalytic domain in the Golgi targeting of newly synthesized Lyn in a manner independent of its kinase activity.
19590497 Analysis of Lyn expression in human skin biopsies of psoriatic patients led to the detection of Lyn cleavage product whose expression correlates with the activation of caspase 1.
19492092 These results highlight a new role for Lyn as an effector of EpoR in controlling Kit expression.
19369946 Combined European-derived population, consisting of 2463 independent cases and 3131 unrelated controls, shows significant association with rs6983130 in a female-only analysis with 2254 cases and 2228 controls.
19369946 Observational study of gene-disease association. (HuGE Navigator)
19340007 The caspase-cleaved form of Lyn exerts a negative feedback on imatinib-mediated CML cell apoptosis that is entirely dependent on its kinase activity and likely on the BCR-ABL pathway.
19290526 B-CLL & CML overexpressed Lyn versus de novo ALL, de novo AML & Philadelphia-negative myeloproliferative neoplasms. AML secondary to myelodysplastic syndromes lacked Lyn. Lyn overexpression in B-CLL was associated with microRNA-337-5p down-regulation.
19258394 These results suggest that SFK trafficking is specified by the palmitoylation state in the SH4 domain.
19234487 Lyn is downstream of Jak2, and Jak2 maintains activated Lyn kinase in CML through the SET-PP2A-Shp1 pathway.
19086053 Observational study of gene-disease association. (HuGE Navigator)
18817770 These results suggest that Lyn being imported into and rapidly exported from the nucleus preferentially accumulates in the nucleus by inhibition of the kinase activity and lipid modification.
18802065 Lyn is an important part of a regulatory network that couples SDF-1/CXCR4-induced monocyte chemotactic signals with down-regulation of beta2 integrin/LFA-1-dependent adhesion to activated brain microvascular endothelial cells.
18768392 Geldanamycin-induced Lyn dissociation from aberrant Hsp90-stabilized cytosolic complex is an early event in apoptotic mechanisms in B-chronic lymphocytic leukemia.
18579528 PLSCR1 is a novel amplifier of FcepsilonRI signaling that acts selectively on the Lyn-initiated LAT/phospholipase Cgamma1/calcium axis, resulting in potentiation of a selected set of mast cell responses
18577747 LYN activation was independent of BCR-ABL in cells from imatinib-resistant chronic myelogenous leukemia patients (CML); LYN kinase may be involved in imatinib resistance in CML patients with mutation-negative BCR-ABL
18457834 These results suggest that Src-family tyrosine kinases, including c-Src and Lyn, are involved in formation of the cortical actin cap, which may serve as a platform of tyrosine phosphorylation signaling.
18453587 The primary M-group HIV-1 Nef proteins (from A, B, C, F, G, H, J, and K subtypes) strongly activate LYN in cells
18363812 P-selectin-PSGL-1-induces TF and IL8 expression through Lyn phosphorylation, and part of the inhibitory effect of IL10 depends on reduced phosphorylation
18272395 A crystal of the mono-phosphorylated sample was diffracted to 3.2A
18235045 Lyn activation is BCR-ABL independent, it is complexed with the Gab2 and c-Cbl adapter/scaffold proteins, and it mediates persistent Gab2 and BCR-ABL tyrosine phosphorylation in the presence or absence of imatinib.
18174230 Observational study of gene-disease association. (HuGE Navigator)
18086677 Thus the phosphorylation and dephosphorylation of caspase-8, mediated by Lyn and SHP-1, respectively, represents a novel, dynamic post-translational mechanism for the regulation of neutrophil apoptosis
18070987 role in control of proliferation and survival in most B-non-Hodgkin lymphomas
17701175 Lyn is weakly phosphorylated in normal B cells, but strongly phosphorylated in myeloma B cells.
17692281 Thus, these results suggest that endogenous c-Src, c-Yes, and Lyn are differentially activated through Cdc2 activation during M phase.
17233630 Hic-5 and paxillin function as negative feedback regulators of Src family kinases in aggregated platelets
17230226 FLT3/ITD (internal tandem duplication)specifically associates with Lyn, phosphorylating Lyn in vivo. FLT3/ITD receptors bind Lyn with a higher affinity than wild-type in vitro. This is relative to the intensity of tyrosyl phosphorylation of the receptor.
16849330 The primary M-group HIV-1 Nef proteins (from A, B, C, F, G, H, J, and K subtypes) strongly activate LYN in cells
16791881 Activation of Lyn and its interaction with rafts and toll-like receptor 2 play an important role in the initial stages of Pseudomonas aeruginosa interaction with host lung cells.
16687414 lysophosphatidic acid-induced IL-8 secretion is partly dependent on EGFR transactivation regulated by PKCdelta-dependent activation of Lyn kinase and MMPs and proHB-EGF
16621960 The primary M-group HIV-1 Nef proteins (from A, B, C, F, G, H, J, and K subtypes) strongly activate LYN in cells
16597828 A key result is that the conformational transition involves a switch in an electrostatic network of six polar residues between the active and the down-regulated conformations. The exchange between interactions links the three main motions of the CD.
16568084 LYN can short-circuit conventional B cell receptor signaling in SLP65-deficient B cell lymphoma cells and thereby promote activation of survival and proliferation-related molecules
16467205 in hematopoietic cells stimulated via CXCR4, Lyn kinase is a positive regulator of cell movement while negatively regulating adhesion to stromal cells by inhibiting the ICAM-1-binding activity of beta(2) integrins
16454711 The primary M-group HIV-1 Nef proteins (from A, B, C, F, G, H, J, and K subtypes) strongly activate LYN in cells
16320343 altered Lyn expression in B cells from a majority of patients with systemic lupus erythematosus
15795233 HS1 Tyr phosphorylation catalyzed by Syk and Lyn plays a crucial role in the translocation of the protein to the membrane and is involved in the cytoskeleton rearrangement triggered by thrombin in human platelets
15744341 The LYN is present in the majority of mediastinal B cell lymphomas.
15665117 Kaposi sarcoma-associated herpesvirus K1 protein-mediated constitutive Lyn kinase activation in K1 lymphoma cells is crucial for the production of VEGF and NF-kappaB activation
15638726 The primary M-group HIV-1 Nef proteins (from A, B, C, F, G, H, J, and K subtypes) strongly activate LYN in cells
15501776 role in the regulation of lipopolysaccharide priming in neutrophils
15262430 LYN amplification is associated with malignant mixed tumor of salivary gland
15190072 LYN and FYN are downregulated by CBL in osteoblast differentiation induced by constitutive FGFR2 activation
15173188 The kinase domain of Lyn plays a role in Lyn trafficking besides catalysis of substrate phosphorylation.
15166241 SHIP1 and Lyn have roles as negative regulators of integrin alpha(IIb)beta(3) adhesive and signaling function
15078178 The primary M-group HIV-1 Nef proteins (from A, B, C, F, G, H, J, and K subtypes) strongly activate LYN in cells
14969582 SRC kinases LYN & HCK let engaged b2 integrins form focal-adhesion-like structures needed for stable shear-resistant PMN adhesion. SRC-dependent outside-in signalling is needed for integrin adhesiveness triggered by a classical chemoattractant like IL-8.
14662334 Two Src kinases are selectively activated by TPO signaling in primary megakaryocytes, Fyn and Lyn, but only Fyn expression is significantly upregulated during MK differentiation, suggesting variable gene regulation.
12882960 SHIP-1 and Lyn have roles in the negative regulation of M-CSF-R-induced Akt activation
12734410 The primary M-group HIV-1 Nef proteins (from A, B, C, F, G, H, J, and K subtypes) strongly activate LYN in cells
12642697 Lyn tyrosine kinase inhibits nuclear export of the p53 tumor suppressor in breast neoplasms
12509383 STI571 resistance is acquired through selection of BCR-ABL independent cells that overexpress src-related kinase LYN
12495897 role in transduction of the TPO proliferative signal in a megakaryocyte cell line
12393728 CD45 tyrosine phosphatase inhibits erythroid differentiation of umbilical cord blood CD34+ cells associated with selective inactivation of Lyn.
11943772 Association of Fyn and Lyn with the proline-rich domain of glycoprotein VI regulates intracellular signaling
11877294 Activation of Lyn kinase is necessary for proliferation of CD45+ myeloma cells by IL-6.
11826756 The Lyn/CD22/SHP-1 pathway is important in autoimmunity. Naive and tolerant B-cells differ in their calcium signaling in response to antigenic stimulation.
10642173 The primary M-group HIV-1 Nef proteins (from A, B, C, F, G, H, J, and K subtypes) strongly activate LYN in cells
10544125 The primary M-group HIV-1 Nef proteins (from A, B, C, F, G, H, J, and K subtypes) strongly activate LYN in cells

AA Sequence

MGCIKSKGKDSLSDDGVDLKTQPVRNTERTIYVRDPTSNKQQRPVPESQLLPGQRFQTKDPEEQGDIVVA      1 - 70
LYPYDGIHPDDLSFKKGEKMKVLEEHGEWWKAKSLLTKKEGFIPSNYVAKLNTLETEEWFFKDITRKDAE     71 - 140
RQLLAPGNSAGAFLIRESETLKGSFSLSVRDFDPVHGDVIKHYKIRSLDNGGYYISPRITFPCISDMIKH    141 - 210
YQKQADGLCRRLEKACISPKPQKPWDKDAWEIPRESIKLVKRLGAGQFGEVWMGYYNNSTKVAVKTLKPG    211 - 280
TMSVQAFLEEANLMKTLQHDKLVRLYAVVTREEPIYIITEYMAKGSLLDFLKSDEGGKVLLPKLIDFSAQ    281 - 350
IAEGMAYIERKNYIHRDLRAANVLVSESLMCKIADFGLARVIEDNEYTAREGAKFPIKWTAPEAINFGCF    351 - 420
TIKSDVWSFGILLYEIVTYGKIPYPGRTNADVMTALSQGYRMPRVENCPDELYDIMKMCWKEKAEERPTF    421 - 490
DYLQSVLDDFYTATEGQYQQQP                                                    491 - 512
//

Text Mined References (335)

PMID Year Title
26708841 2015 LYN, a Key Gene From Bioinformatics Analysis, Contributes to Development and Progression of Esophageal Adenocarcinoma.
26517678 2015 Inhibition of Lyn is a promising treatment for mantle cell lymphoma with bortezomib resistance.
26460485 2015 Deregulated Expression of SRC, LYN and CKB Kinases by DNA Methylation and Its Potential Role in Gastric Cancer Invasiveness and Metastasis.
26308013 2015 Astaxanthin Improves Human Sperm Capacitation by Inducing Lyn Displacement and Activation.
26055819 2015 Src-family-tyrosine kinase Lyn is critical for TLR2-mediated NF-?B activation through the PI 3-kinase signaling pathway.
25967238 2015 The focal adhesion kinase Pyk2 links Ca2+ signalling to Src family kinase activation and protein tyrosine phosphorylation in thrombin-stimulated platelets.
25965880 2015 CBL controls a tyrosine kinase network involving AXL, SYK and LYN in nilotinib-resistant chronic myeloid leukaemia.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25823815 2015 Lyn modulates Claudin-2 expression and is a therapeutic target for breast cancer liver metastasis.
25817574 2015 GW5074 and PP2 kinase inhibitors implicate nontraditional c-Raf and Lyn function as drivers of retinoic acid-induced maturation.
25814554 2015 Phospho-tyrosine dependent protein-protein interaction network.
25418321 2015 Direct interaction, instrumental for signaling processes, between LacCer and Lyn in the lipid rafts of neutrophil-like cells.
25401474 2014 LYN-activating mutations mediate antiestrogen resistance in estrogen receptor-positive breast cancer.
25255805 2014 Global profiling of co- and post-translationally N-myristoylated proteomes in human cells.
25173936 2014 Lyn tyrosine kinase promotes silencing of ATM-dependent checkpoint signaling during recovery from DNA double-strand breaks.
25104351 2014 Activation of Lyn tyrosine kinase through decreased membrane cholesterol levels during a change in its membrane distribution upon cell detachment.
24852370 2014 Genome-wide association study identifies a novel susceptibility gene for serum TSH levels in Chinese populations.
24728074 2014 Enhanced prediction of Src homology 2 (SH2) domain binding potentials using a fluorescence polarization-derived c-Met, c-Kit, ErbB, and androgen receptor interactome.
24686085 2014 Phosphorylation of c-Cbl and p85 PI3K driven by all-trans retinoic acid and CD38 depends on Lyn kinase activity.
24658140 2014 The mammalian-membrane two-hybrid assay (MaMTH) for probing membrane-protein interactions in human cells.
24469048 2015 Juvenile myelomonocytic leukaemia-associated mutation in Cbl promotes resistance to apoptosis via the Lyn-PI3K/AKT pathway.
24407241 2014 PSTPIP2 dysregulation contributes to aberrant terminal differentiation in GATA-1-deficient megakaryocytes by activating LYN.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24217950 2014 Ligand-dependent activation of EphA4 signaling regulates the proteolysis of amyloid precursor protein through a Lyn-mediated pathway.
24108461 2013 A critical role for Lyn kinase in strengthening endothelial integrity and barrier function.
24091144 Expression of LYN and PTEN genes in chronic myeloid leukemia and their importance in therapeutic strategy.
23975833 2014 Tumor necrosis factor-like weak inducer of apoptosis (TWEAK) promotes glioblastoma cell chemotaxis via Lyn activation.
23949219 2013 MBNL142 and MBNL143 gene isoforms, overexpressed in DM1-patient muscle, encode for nuclear proteins interacting with Src family kinases.
23918783 2013 Requirement and redundancy of the Src family kinases Fyn and Lyn in perforin-dependent killing of Cryptococcus neoformans by NK cells.
23896410 2013 The Src and c-Kit kinase inhibitor dasatinib enhances p53-mediated targeting of human acute myeloid leukemia stem cells by chemotherapeutic agents.
23866081 2013 Lyn, a Src family kinase, regulates activation of epidermal growth factor receptors in lung adenocarcinoma cells.
23764002 2013 Epidermal growth factor receptor potentiates MCM7-mediated DNA replication through tyrosine phosphorylation of Lyn kinase in human cancers.
23696637 2013 CBL linker region and RING finger mutations lead to enhanced granulocyte-macrophage colony-stimulating factor (GM-CSF) signaling via elevated levels of JAK2 and LYN.
23583449 2013 A crucial role for Lyn in TIMP-1 erythroid cell survival signalling pathway.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23450709 2013 MicroRNA-30a promotes B cell hyperactivity in patients with systemic lupus erythematosus by direct interaction with Lyn.
23396948 2013 The structural wedge domain of the receptor-like tyrosine phosphatase CD45 enforces B cell tolerance by regulating substrate specificity.
23378338 2013 Involvement of Lyn and the atypical kinase SgK269/PEAK1 in a basal breast cancer signaling pathway.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23223229 2013 The Dok-3/Grb2 protein signal module attenuates Lyn kinase-dependent activation of Syk kinase in B cell antigen receptor microclusters.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23039362 2013 Expression levels of Lyn, Syk, PLC?2 and ERK in patients with chronic lymphocytic leukemia, and higher levels of Lyn are associated with a shorter treatment-free survival.
23001182 2012 Interactions among HCLS1, HAX1 and LEF-1 proteins are essential for G-CSF-triggered granulopoiesis.
22895079 2012 Oridonin in combination with imatinib exerts synergetic anti-leukemia effect in Ph+ acute lymphoblastic leukemia cells in vitro by inhibiting activation of LYN/mTOR signaling pathway.
22845063 2012 The interaction between Lyn and Fc?RI? is indispensable for Fc?RI-mediated human mast cell activation.
22731636 2012 Lyn is involved in CD24-induced ERK1/2 activation in colorectal cancer.
22624718 2012 Tetraspanin CD37 directly mediates transduction of survival and apoptotic signals.
22581261 2012 DOCK8 functions as an adaptor that links TLR-MyD88 signaling to B cell activation.
22490227 2012 Lyn kinase mediates cell motility and tumor growth in EGFRvIII-expressing head and neck cancer.
22430206 2013 Yes and Lyn play a role in nuclear translocation of the epidermal growth factor receptor.
22393415 2012 Nef alleles from all major HIV-1 clades activate Src-family kinases and enhance HIV-1 replication in an inhibitor-sensitive manner.
22246800 2012 The role of the Src family kinase Lyn in the immunomodulatory activities of cathelicidin peptide LL-37 on monocytic cells.
21978158 2011 Blockade of Lyn kinase upregulates both canonical and non-canonical TLR-3 pathways in THP-1 monocytes exposed to human cytomegalovirus.
21951684 2011 Erythrocyte membrane changes of chorea-acanthocytosis are the result of altered Lyn kinase activity.
21930792 2011 SCIMP, a transmembrane adaptor protein involved in major histocompatibility complex class II signaling.
21918188 2011 Myeloid differentiation factor-2 interacts with Lyn kinase and is tyrosine phosphorylated following lipopolysaccharide-induced activation of the TLR4 signaling pathway.
21749309 2011 Heterogeneous expression of Src tyrosine kinases Lyn, Fyn and Syk in classical Hodgkin lymphoma: prognostic implications.
21730355 2011 Quantitative phosphoproteomics revealed interplay between Syk and Lyn in the resistance to nilotinib in chronic myeloid leukemia cells.
21628423 2011 The non-receptor tyrosine kinase Lyn controls neutrophil adhesion by recruiting the CrkL-C3G complex and activating Rap1 at the leading edge.
21513978 2011 PTPIP51 is phosphorylated by Lyn and c-Src kinases lacking dephosphorylation by PTP1B in acute myeloid leukemia.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21345943 2011 Association of SRC-related kinase Lyn with the interleukin-2 receptor and its role in maintaining constitutive phosphorylation of JAK/STAT in human T-cell leukemia virus type 1-transformed T cells.
21106848 2011 Chemoattractant-induced signaling via the Ras-ERK and PI3K-Akt networks, along with leukotriene C4 release, is dependent on the tyrosine kinase Lyn in IL-5- and IL-3-primed human blood eosinophils.
20962850 2011 A targeted association study in systemic lupus erythematosus identifies multiple susceptibility alleles.
20693279 2010 Lyn kinase-dependent regulation of miR181 and myeloid cell leukemia-1 expression: implications for drug resistance in myelogenous leukemia.
20679348 2010 Suppression of ADAM17-mediated Lyn/Akt pathways induces apoptosis of human leukemia U937 cells: Bungarus multicinctus protease inhibitor-like protein-1 uncovers the cytotoxic mechanism.
20605918 2010 The Lyn kinase C-lobe mediates Golgi export of Lyn through conformation-dependent ACSL3 association.
20561033 2010 The sphingolipid-rich rafts of ALK+ lymphomas downregulate the Lyn-Cbp/PAG signalosome.
20546612 2010 The role of height-associated loci identified in genome wide association studies in the determination of pediatric stature.
20534535 2010 Regulation of PTEN/Akt and MAP kinase signaling pathways by the ubiquitin ligase activators Ndfip1 and Ndfip2.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20215510 2010 LYN is a mediator of epithelial-mesenchymal transition and a target of dasatinib in breast cancer.
20189992 2010 An important role of the SRC family kinase Lyn in stimulating platelet granule secretion.
20159608 2010 Matrix metalloproteinase-9 promotes chronic lymphocytic leukemia b cell survival through its hemopexin domain.
20079716 2010 A novel signaling pathway associated with Lyn, PI 3-kinase and Akt supports the proliferation of myeloma cells.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20056178 2010 Polymorphisms in innate immunity genes and patients response to dendritic cell-based HIV immuno-treatment.
20037584 2010 CD36 ligands promote sterile inflammation through assembly of a Toll-like receptor 4 and 6 heterodimer.
20028775 2010 The T cell receptor-mediated phosphorylation of Pyk2 tyrosines 402 and 580 occurs via a distinct mechanism than other receptor systems.
19965664 2010 Rituximab inhibits B-cell receptor signaling.
19893451 2009 Resequencing analysis of the human tyrosine kinase gene family in pancreatic cancer.
19857964 2009 Structural basis for the inhibitor recognition of human Lyn kinase domain.
19807924 2009 Identification of SH3 domain interaction partners of human FasL (CD178) by phage display screening.
19718658 2009 Alternative splicing of ADAM15 regulates its interactions with cellular SH3 proteins.
19710703 2010 Identification of a novel TEL-Lyn fusion gene in primary myelofibrosis.
19641380 2009 Candidate gene polymorphisms for diabetes mellitus, cardiovascular disease and cancer are associated with longevity in Koreans.
19619611 2009 Requirement of the SH4 and tyrosine-kinase domains but not the kinase activity of Lyn for its biosynthetic targeting to caveolin-positive Golgi membranes.
19590497 2009 The caspase-cleaved form of LYN mediates a psoriasis-like inflammatory syndrome in mice.
19492092 2009 Erythropoietin down-regulates stem cell factor receptor (Kit) expression in the leukemic proerythroblast: role of Lyn kinase.
19369946 2009 Genetic associations of LYN with systemic lupus erythematosus.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19340007 2009 Inhibition of imatinib-mediated apoptosis by the caspase-cleaved form of the tyrosine kinase Lyn in chronic myelogenous leukemia cells.
19290919 2009 Multiple roles of Lyn kinase in myeloid cell signaling and function.
19290526 2009 Opposite expression pattern of Src kinase Lyn in acute and chronic haematological malignancies.
19258394 2009 Differential trafficking of Src, Lyn, Yes and Fyn is specified by the state of palmitoylation in the SH4 domain.
19234487 2009 Jak2 inhibition deactivates Lyn kinase through the SET-PP2A-SHP1 pathway, causing apoptosis in drug-resistant cells from chronic myelogenous leukemia patients.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
18817770 2008 Nuclear localization of Lyn tyrosine kinase mediated by inhibition of its kinase activity.
18802065 2008 Monocyte migration and LFA-1-mediated attachment to brain microvascular endothelia is regulated by SDF-1 alpha through Lyn kinase.
18772004 2008 New insights on mast cell activation via the high affinity receptor for IgE.
18768392 2008 Geldanamycin-induced Lyn dissociation from aberrant Hsp90-stabilized cytosolic complex is an early event in apoptotic mechanisms in B-chronic lymphocytic leukemia.
18697750 2008 Gab2 is involved in differential phosphoinositide 3-kinase signaling by two splice forms of c-Kit.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18579528 2008 Phospholipid scramblase 1 modulates a selected set of IgE receptor-mediated mast cell responses through LAT-dependent pathway.
18577747 2008 Association between imatinib-resistant BCR-ABL mutation-negative leukemia and persistent activation of LYN kinase.
18457834 2008 Role of Src-family kinases in formation of the cortical actin cap at the dorsal cell surface.
18391951 2008 Many sequence variants affecting diversity of adult human height.
18363812 2008 Tissue factor and IL8 production by P-selectin-dependent platelet-monocyte aggregates in whole blood involves phosphorylation of Lyn and is inhibited by IL10.
18272395 2008 Protein purification and preliminary crystallographic analysis of human Lyn tyrosine kinase.
18235045 2008 Lyn regulates BCR-ABL and Gab2 tyrosine phosphorylation and c-Cbl protein stability in imatinib-resistant chronic myelogenous leukemia cells.
18174230 2008 Association of polymorphisms in complement component C3 gene with susceptibility to systemic lupus erythematosus.
18088087 2008 Phosphoproteome of resting human platelets.
18086677 2008 Dynamic regulation of neutrophil survival through tyrosine phosphorylation or dephosphorylation of caspase-8.
18070987 2008 Oncogenic association of the Cbp/PAG adaptor protein with the Lyn tyrosine kinase in human B-NHL rafts.
18056483 2008 A critical role for Lyn in acute myeloid leukemia.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17977829 2007 TOM1L1 is a Lyn substrate involved in FcepsilonRI signaling in mast cells.
17910947 2007 Identification of twinfilin-2 as a factor involved in neurite outgrowth by RNAi-based screen.
17701175 2007 Signaling status of IgG B cell receptor (IgG BCR) is indicative for an activated state of circulating B cells in multiple myeloma.
17692281 2007 Differential mitotic activation of endogenous c-Src, c-Yes, and Lyn in HeLa cells.
17640867 2007 Leupaxin negatively regulates B cell receptor signaling.
17462920 2007 C-type lectin DC-SIGN modulates Toll-like receptor signaling via Raf-1 kinase-dependent acetylation of transcription factor NF-kappaB.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17254966 2007 Cdk-inhibitory activity and stability of p27Kip1 are directly regulated by oncogenic tyrosine kinases.
17233630 2007 Paxillin family members function as Csk-binding proteins that regulate Lyn activity in human and murine platelets.
17230226 2007 Lyn is an important component of the signal transduction pathway specific to FLT3/ITD and can be a therapeutic target in the treatment of AML with FLT3/ITD.
17192257 2007 Proteomics analysis of protein kinases by target class-selective prefractionation and tandem mass spectrometry.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16921024 2006 Differential kinase requirements in human and mouse Fc-gamma receptor phagocytosis and endocytosis.
16920712 2006 Csk-binding protein mediates sequential enzymatic down-regulation and degradation of Lyn in erythropoietin-stimulated cells.
16912036 2006 Src family kinases phosphorylate the Bcr-Abl SH3-SH2 region and modulate Bcr-Abl transforming activity.
16801133 2006 The duplicitous nature of the Lyn tyrosine kinase in growth factor signaling.
16799092 2006 Dynamic profiling of the post-translational modifications and interaction partners of epidermal growth factor receptor signaling after stimulation by epidermal growth factor using Extended Range Proteomic Analysis (ERPA).
16791881 2006 Src kinase Lyn is crucial for Pseudomonas aeruginosa internalization into lung cells.
16687414 2006 Regulation of lysophosphatidic acid-induced epidermal growth factor receptor transactivation and interleukin-8 secretion in human bronchial epithelial cells by protein kinase Cdelta, Lyn kinase, and matrix metalloproteinases.
16597828 2006 Src kinase activation: A switched electrostatic network.
16568084 2006 The SRC family kinase LYN redirects B cell receptor signaling in human SLP65-deficient B cell lymphoma cells.
16467205 2006 Integrin inhibition through Lyn-dependent cross talk from CXCR4 chemokine receptors in normal human CD34+ marrow cells.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16320343 2005 Decreased Lyn expression and translocation to lipid raft signaling domains in B lymphocytes from patients with systemic lupus erythematosus.
16316995 2006 IgE-dependent activation of sphingosine kinases 1 and 2 and secretion of sphingosine 1-phosphate requires Fyn kinase and contributes to mast cell responses.
16249387 2006 LIME acts as a transmembrane adapter mediating BCR-dependent B-cell activation.
16155203 2005 Structural characterization of Lyn-SH3 domain in complex with a herpesviral protein reveals an extended recognition motif that enhances binding affinity.
16129412 2005 Signaling by Kit protein-tyrosine kinase--the stem cell factor receptor.
15795233 2005 Thrombin-induced tyrosine phosphorylation of HS1 in human platelets is sequentially catalyzed by Syk and Lyn tyrosine kinases and associated with the cellular migration of the protein.
15784897 2005 Further studies on hepatitis C virus NS5A-SH3 domain interactions: identification of residues critical for binding and implications for viral RNA replication and modulation of cell signalling.
15744341 2005 Expression pattern of intracellular leukocyte-associated proteins in primary mediastinal B cell lymphoma.
15665117 2005 Activation of Src kinase Lyn by the Kaposi sarcoma-associated herpesvirus K1 protein: implications for lymphomagenesis.
15664155 2005 Lyn tyrosine kinase: accentuating the positive and the negative.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15546919 2004 ARAP3 is transiently tyrosine phosphorylated in cells attaching to fibronectin and inhibits cell spreading in a RhoGAP-dependent manner.
15501776 2004 Role of protein tyrosine kinase p53/56lyn in diminished lipopolysaccharide priming of formylmethionylleucyl- phenylalanine-induced superoxide production in human newborn neutrophils.
15491611 2004 Conserved residues in the HIV-1 Nef hydrophobic pocket are essential for recruitment and activation of the Hck tyrosine kinase.
15489917 2004 Src-family kinases in B-cell development and signaling.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15262430 2004 Amplification of MGC2177, PLAG1, PSMC6P, and LYN in a malignant mixed tumor of salivary gland detected by cDNA microarray with tyramide signal amplification.
15220000 2004 Src-family kinases: rheostats of immune cell signaling.
15190072 2004 Cbl-mediated degradation of Lyn and Fyn induced by constitutive fibroblast growth factor receptor-2 activation supports osteoblast differentiation.
15173188 2004 Trafficking of Lyn through the Golgi caveolin involves the charged residues on alphaE and alphaI helices in the kinase domain.
15166241 2004 SHIP1 and Lyn Kinase Negatively Regulate Integrin alpha IIb beta 3 signaling in platelets.
15144186 2004 Robust phosphoproteomic profiling of tyrosine phosphorylation sites from human T cells using immobilized metal affinity chromatography and tandem mass spectrometry.
14993658 2004 The hepatitis C virus NS5A protein binds to members of the Src family of tyrosine kinases and regulates kinase activity.
14969582 2004 SRC-dependent outside-in signalling is a key step in the process of autoregulation of beta2 integrins in polymorphonuclear cells.
14726379 2004 Lyn tyrosine kinase regulates thrombopoietin-induced proliferation of hematopoietic cell lines and primary megakaryocytic progenitors.
14667819 2004 Analysis of a high-throughput yeast two-hybrid system and its use to predict the function of intracellular proteins encoded within the human MHC class III region.
14662334 2003 Identification and activation of Src family kinases in primary megakaryocytes.
12923167 2003 Tyrosyl phosphorylation of Shp2 is required for normal ERK activation in response to some, but not all, growth factors.
12882960 2003 The inositol 5'-phosphatase SHIP-1 and the Src kinase Lyn negatively regulate macrophage colony-stimulating factor-induced Akt activity.
12846735 2003 Clustering-induced tyrosine phosphorylation of nephrin by Src family kinases.
12750561 DF3/MUC1 signaling in multiple myeloma cells is regulated by interleukin-7.
12670955 2003 A lipid raft environment enhances Lyn kinase activity by protecting the active site tyrosine from dephosphorylation.
12642697 Lyn tyrosine kinase inhibits nuclear export of the p53 tumor suppressor.
12588871 2003 Src-mediated RGS16 tyrosine phosphorylation promotes RGS16 stability.
12586738 2003 The p54 cleaved form of the tyrosine kinase Lyn generated by caspases during BCR-induced cell death in B lymphoma acts as a negative regulator of apoptosis.
12538589 2003 Regulation of a transient receptor potential (TRP) channel by tyrosine phosphorylation. SRC family kinase-dependent tyrosine phosphorylation of TRPV4 on TYR-253 mediates its response to hypotonic stress.
12509383 2003 BCR-ABL independence and LYN kinase overexpression in chronic myelogenous leukemia cells selected for resistance to STI571.
12496276 2003 Identification of UNC119 as a novel activator of SRC-type tyrosine kinases.
12495897 2002 Lyn kinase is activated following thrombopoietin stimulation of the megakaryocytic cell line B1647.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12468540 2003 The role of C-terminal tyrosine phosphorylation in the regulation of SHP-1 explored via expressed protein ligation.
12456510 2003 Felic (CIP4b), a novel binding partner with the Src kinase Lyn and Cdc42, localizes to the phagocytic cup.
12393728 2002 CD45 tyrosine phosphatase inhibits erythroid differentiation of umbilical cord blood CD34+ cells associated with selective inactivation of Lyn.
12181444 2002 Activation of phospholipase Cgamma2 by tyrosine phosphorylation.
12149655 2002 Repression of c-Cbl leads to enhanced G-CSF Jak-STAT signaling without increased cell proliferation.
12096713 2002 Activation of Pyk2/RAFTK induces tyrosine phosphorylation of alpha-synuclein via Src-family kinases.
12095152 2002 Activation of extracellular signal-regulated kinase through B-cell antigen receptor in B-cell chronic lymphocytic leukemia.
11971018 2002 The adapter molecule Gab2 regulates Fc epsilon RI-mediated signal transduction in mast cells.
11955060 2002 Structural investigation of the binding of a herpesviral protein to the SH3 domain of tyrosine kinase Lck.
11943772 2002 Association of Fyn and Lyn with the proline-rich domain of glycoprotein VI regulates intracellular signaling.
11877294 2002 Requirements of src family kinase activity associated with CD45 for myeloma cell proliferation by interleukin-6.
11826756 2002 Lyn/CD22/SHP-1 and their importance in autoimmunity.
11825908 2002 Phosphatidylinositol 3-kinase and Src family kinases are required for phosphorylation and membrane recruitment of Dok-1 in c-Kit signaling.
11823534 2002 Lyn tyrosine kinase is important for IL-5-stimulated eosinophil differentiation.
11782428 2002 BANK regulates BCR-induced calcium mobilization by promoting tyrosine phosphorylation of IP(3) receptor.
11744621 2002 Multiple phosphorylation of alpha-synuclein by protein tyrosine kinase Syk prevents eosin-induced aggregation.
11739737 2002 Gab3, a new DOS/Gab family member, facilitates macrophage differentiation.
11602604 2001 RGS16 function is regulated by epidermal growth factor receptor-mediated tyrosine phosphorylation.
11598012 2001 PKCbeta modulates antigen receptor signaling via regulation of Btk membrane localization.
11594778 2001 Phosphorylation of human N-myristoyltransferase by N-myristoylated SRC family tyrosine kinase members.
11536198 2001 Tyrosine phosphorylation of p190 RhoGAP by Fyn regulates oligodendrocyte differentiation.
11526478 2001 Cleavage of Fyn and Lyn in their N-terminal unique regions during induction of apoptosis: a new mechanism for Src kinase regulation.
11524430 2001 Src family kinases mediate receptor-stimulated, phosphoinositide 3-kinase-dependent, tyrosine phosphorylation of dual adaptor for phosphotyrosine and 3-phosphoinositides-1 in endothelial and B cell lines.
11517336 2001 Interaction between growth arrest-DNA damage protein 34 and Src kinase Lyn negatively regulates genotoxic apoptosis.
11514608 2001 B cell adaptor containing src homology 2 domain (BASH) links B cell receptor signaling to the activation of hematopoietic progenitor kinase 1.
11448999 2001 Vav2 is required for cell spreading.
11443118 2001 CrkL is recruited through its SH2 domain to the erythropoietin receptor and plays a role in Lyn-mediated receptor signaling.
11435302 2001 Lyn is required for normal stem cell factor-induced proliferation and chemotaxis of primary hematopoietic cells.
11389892 2001 B cell receptor signaling involves physical and functional association of FAK with Lyn and IgM.
11388899 2001 Detergent-resistant membrane domains are required for mast cell activation but dispensable for tyrosine phosphorylation upon aggregation of the high affinity receptor for IgE.
11358993 2001 Protein kinase C theta is expressed in mast cells and is functionally involved in Fcepsilon receptor I signaling.
11313396 2001 CD24 induces apoptosis in human B cells via the glycolipid-enriched membrane domains/rafts-mediated signaling system.
11311138 2001 Monocyte chemoattractant protein 1 causes differential signalling mediated by proline-rich tyrosine kinase 2 in THP-1 cells.
11306681 2001 Molecular cloning, genomic positioning, promoter identification, and characterization of the novel cyclic amp-specific phosphodiesterase PDE4A10.
11301322 2001 PRAM-1 is a novel adaptor protein regulated by retinoic acid (RA) and promyelocytic leukemia (PML)-RA receptor alpha in acute promyelocytic leukemia cells.
11226282 2001 BLNK mediates Syk-dependent Btk activation.
11162638 2001 Activated Fyn phosphorylates alpha-synuclein at tyrosine residue 125.
11131153 2000 IL-2 induces the association of IL-2Rbeta, lyn, and MAP kinase ERK-1 in human neutrophils.
11110698 2000 Fyn and Lyn phosphorylate the Fc receptor gamma chain downstream of glycoprotein VI in murine platelets, and Lyn regulates a novel feedback pathway.
11104670 2000 The C-terminus of NIPP1 (nuclear inhibitor of protein phosphatase-1) contains a novel binding site for protein phosphatase-1 that is controlled by tyrosine phosphorylation and RNA binding.
11071635 2000 Stem cell factor induces phosphatidylinositol 3'-kinase-dependent Lyn/Tec/Dok-1 complex formation in hematopoietic cells.
11046148 2000 Latent membrane protein 2A of Epstein-Barr virus binds WW domain E3 protein-ubiquitin ligases that ubiquitinate B-cell tyrosine kinases.
11042209 2001 The SH2 domain containing tyrosine phosphatase-1 down-regulates activation of Lyn and Lyn-induced tyrosine phosphorylation of the CD19 receptor in B cells.
10945997 2000 cAMP-dependent protein kinase phosphorylation of EVL, a Mena/VASP relative, regulates its interaction with actin and SH3 domains.
10945993 2000 Phosphorylation of protein kinase Cdelta on distinct tyrosine residues regulates specific cellular functions.
10942405 2000 Sequential phosphorylation of protein band 3 by Syk and Lyn tyrosine kinases in intact human erythrocytes: identification of primary and secondary phosphorylation sites.
10933394 2000 CD19 regulates Src family protein tyrosine kinase activation in B lymphocytes through processive amplification.
10891478 2000 Role for Lyn tyrosine kinase as a regulator of stress-activated protein kinase activity in response to DNA damage.
10872802 2000 Molecular cloning of the mouse APS as a member of the Lnk family adaptor proteins.
10861086 2000 Differential involvement of Src family kinases in Fc gamma receptor-mediated phagocytosis.
10858437 2000 Collagen, convulxin, and thrombin stimulate aggregation-independent tyrosine phosphorylation of CD31 in platelets. Evidence for the involvement of Src family kinases.
10790433 2000 Phosphoprotein associated with glycosphingolipid-enriched microdomains (PAG), a novel ubiquitously expressed transmembrane adaptor protein, binds the protein tyrosine kinase csk and is involved in regulation of T cell activation.
10749872 2000 Characterization of the human B cell RAG-associated gene, hBRAG, as a B cell receptor signal-enhancing glycoprotein dimer that associates with phosphorylated proteins in resting B cells.
10748115 2000 Substrate recognition by the Lyn protein-tyrosine kinase. NMR structure of the immunoreceptor tyrosine-based activation motif signaling region of the B cell antigen receptor.
10733577 2000 Dok-3, a novel adapter molecule involved in the negative regulation of immunoreceptor signaling.
10633085 2000 Interaction of folate receptor with signaling molecules lyn and G(alpha)(i-3) in detergent-resistant complexes from the ovary carcinoma cell line IGROV1.
10586033 1999 Regulated association between the tyrosine kinase Emt/Itk/Tsk and phospholipase-C gamma 1 in human T lymphocytes.
10574931 1999 Functional interaction between SHPTP1 and the Lyn tyrosine kinase in the apoptotic response to DNA damage.
10564259 1999 Mechanisms of G2 arrest in response to overexpression of p53.
10488096 1999 SHP-1 regulates Lck-induced phosphatidylinositol 3-kinase phosphorylation and activity.
10469124 1999 Evidence that phospholipase C-gamma2 interacts with SLP-76, Syk, Lyn, LAT and the Fc receptor gamma-chain after stimulation of the collagen receptor glycoprotein VI in human platelets.
10432313 1999 Lyn is activated during late G1 of stem-cell-factor-induced cell cycle progression in haemopoietic cells.
10415030 1999 CD45 negatively regulates lyn activity by dephosphorylating both positive and negative regulatory tyrosine residues in immature B cells.
10403844 1999 Selective association of the tyrosine kinases Src, Fyn, and Lyn with integrin-rich actin cytoskeletons of activated, nonaggregated platelets.
10362357 1999 cbl-3: a new mammalian cbl family protein.
10339479 1999 A common signaling pathway via Syk and Lyn tyrosine kinases generated from capping of the sialomucins CD34 and CD43 in immature hematopoietic cells.
10327049 1999 Paired immunoglobulin-like receptor B (PIR-B) inhibits BCR-induced activation of Syk and Btk by SHP-1.
10318860 1999 Nitric oxide inhibits thrombin receptor-activating peptide-induced phosphoinositide 3-kinase activity in human platelets.
10206997 1999 Association with the SRC family tyrosyl kinase LYN triggers a conformational change in the catalytic region of human cAMP-specific phosphodiesterase HSPDE4A4B. Consequences for rolipram inhibition.
10066823 1999 Molecular features underlying the sequential phosphorylation of HS1 protein and its association with c-Fgr protein-tyrosine kinase.
10026222 1999 Tyrosine phosphorylation of SLP-76 is downstream of Syk following stimulation of the collagen receptor in platelets.
9973406 1999 The mapping of the Lyn kinase binding site of the common beta subunit of IL-3/granulocyte-macrophage colony-stimulating factor/IL-5 receptor.
9892651 1999 PSD-95 promotes Fyn-mediated tyrosine phosphorylation of the N-methyl-D-aspartate receptor subunit NR2A.
9892356 1999 The AMPA receptor interacts with and signals through the protein tyrosine kinase Lyn.
9837776 1998 RA70 is a src kinase-associated protein expressed ubiquitously.
9820500 1998 Syk- and Lyn-dependent phosphorylation of Syk on multiple tyrosines following B cell activation includes a site that negatively regulates signaling.
9819391 1998 ASAP1, a phospholipid-dependent arf GTPase-activating protein that associates with and is phosphorylated by Src.
9799234 1998 Kit signaling through PI 3-kinase and Src kinase pathways: an essential role for Rac1 and JNK activation in mast cell proliferation.
9748231 1998 Regulation of DNA-dependent protein kinase by the Lyn tyrosine kinase.
9712716 1998 Src family tyrosine kinases associate with and phosphorylate CTLA-4 (CD152).
9687533 1998 T cell receptor (TCR) interacting molecule (TRIM), a novel disulfide-linked dimer associated with the TCR-CD3-zeta complex, recruits intracellular signaling proteins to the plasma membrane.
9633884 1998 Interferon alpha activates the tyrosine kinase Lyn in haemopoietic cells.
9581808 1998 Inhibition of p130cas tyrosine phosphorylation by calyculin A.
9573010 1998 Lyn physically associates with the erythropoietin receptor and may play a role in activation of the Stat5 pathway.
9531288 1998 Asymmetrical phosphorylation and function of immunoreceptor tyrosine-based activation motif tyrosines in B cell antigen receptor signal transduction.
9446655 1998 Expression and activation of the nonreceptor tyrosine kinase Tec in human B cells.
9427690 1998 Physical and functional association of Fc alpha R with protein tyrosine kinase Lyn.
9341198 1997 Lyn associates with the juxtamembrane region of c-Kit and is activated by stem cell factor in hematopoietic cell lines and normal progenitor cells.
9295288 1997 A novel association of Fc receptor gamma-chain with glycoprotein VI and their co-expression as a collagen receptor in human platelets.
9232445 1997 Fc gamma receptor type IIb induced recruitment of inositol and protein phosphatases to the signal transductory complex of human B-cell.
9202419 1997 Lyn, a src-like tyrosine kinase.
9195899 1997 Molecular cloning of SKAP55, a novel protein that associates with the protein tyrosine kinase p59fyn in human T-lymphocytes.
9171348 1997 Translocation of the Csk homologous kinase (Chk/Hyl) controls activity of CD36-anchored Lyn tyrosine kinase in thrombin-stimulated platelets.
9104825 1997 Role of tyrosine phosphorylation of HS1 in B cell antigen receptor-mediated apoptosis.
9045636 1997 Interaction between Sam68 and Src family tyrosine kinases, Fyn and Lck, in T cell receptor signaling.
9028946 1997 A collagen-like peptide stimulates tyrosine phosphorylation of syk and phospholipase C gamma2 in platelets independent of the integrin alpha2beta1.
9020138 1997 Involvement of p130(Cas) and p105(HEF1), a novel Cas-like docking protein, in a cytoskeleton-dependent signaling pathway initiated by ligation of integrin or antigen receptor on human B cells.
8943850 1996 CD10/neutral endopeptidase 24.11 is phosphorylated by casein kinase II and coassociates with other phosphoproteins including the lyn src-related kinase.
8943427 1996 Critical role of Lyn kinase in inhibition of neutrophil apoptosis by granulocyte-macrophage colony-stimulating factor.
8910336 1996 The protein-tyrosine kinase Lck associates with and is phosphorylated by Cdc2.
8885868 1996 Protein kinase C mu (PKC mu) associates with the B cell antigen receptor complex and regulates lymphocyte signaling.
8806683 1996 Interaction of cyclin-dependent kinase 2 and the Lyn tyrosine kinase in cells treated with 1-beta-D-arabinofuranosylcytosine.
8756631 1996 In vivo and in vitro specificity of protein tyrosine kinases for immunoglobulin G receptor (FcgammaRII) phosphorylation.
8753773 1996 Association of CD24 with the kinase c-fgr in a small cell lung cancer cell line and with the kinase lyn in an erythroleukemia cell line.
8705993 1996 Nuclear signaling induced by ionizing radiation involves colocalization of the activated p56/p53lyn tyrosine kinase with p34cdc2.
8692915 1996 The stress response to ionizing radiation involoves c-Abl-dependent phosphorylation of SHPTP1.
8657103 1996 Phospholipase C-gamma1 interacts with conserved phosphotyrosyl residues in the linker region of Syk and is a substrate for Syk.
8647200 1996 Involvement of p72syk kinase, p53/56lyn kinase and phosphatidyl inositol-3 kinase in signal transduction via the human B lymphocyte antigen CD22.
8630736 1996 Regulation of Btk function by a major autophosphorylation site within the SH3 domain.
8629002 1996 Activation of BTK by a phosphorylation mechanism initiated by SRC family kinases.
8621719 1996 p120cbl is a major substrate of tyrosine phosphorylation upon B cell antigen receptor stimulation and interacts in vivo with Fyn and Syk tyrosine kinases, Grb2 and Shc adaptors, and the p85 subunit of phosphatidylinositol 3-kinase.
8621063 1996 Tec protein-tyrosine kinase is an effector molecule of Lyn protein-tyrosine kinase.
8612628 1996 A comparative study of the phosphotyrosyl phosphatase specificity of protein phosphatase type 2A and phosphotyrosyl phosphatase type 1B using phosphopeptides and the phosphoproteins p50/HS1, c-Fgr and Lyn.
8395016 1993 Mapping of sites on the Src family protein tyrosine kinases p55blk, p59fyn, and p56lyn which interact with the effector molecules phospholipase C-gamma 2, microtubule-associated protein kinase, GTPase-activating protein, and phosphatidylinositol 3-kinase.
8197119 1994 Granulocyte colony-stimulating factor receptor signaling involves the formation of a three-component complex with Lyn and Syk protein-tyrosine kinases.
8125304 1994 The cDNAs encoding two forms of the LYN protein tyrosine kinase are expressed in rat mast cells and human myeloid cells.
8114715 1994 Lck-dependent tyrosyl phosphorylation of the phosphotyrosine phosphatase SH-PTP1 in murine T cells.
8084605 1994 p56/p53lyn tyrosine kinase activation in mammalian cells treated with mitomycin C.
8064233 1994 Physical and functional association of the high affinity immunoglobulin G receptor (Fc gamma RI) with the kinases Hck and Lyn.
8058772 1994 Binding of Bruton's tyrosine kinase to Fyn, Lyn, or Hck through a Src homology 3 domain-mediated interaction.
8051175 1994 Activation of Src-like p56/p53lyn tyrosine kinase by ionizing radiation.
7935444 1994 Functional analysis of Csk in signal transduction through the B-cell antigen receptor.
7895172 1995 Integral membrane protein 2 of Epstein-Barr virus regulates reactivation from latency through dominant negative effects on protein-tyrosine kinases.
7859737 1995 Proline-rich (PxxP) motifs in HIV-1 Nef bind to SH3 domains of a subset of Src kinases and are required for the enhanced growth of Nef+ viruses but not for down-regulation of CD4.
7831290 1995 Human spleen tyrosine kinase p72Syk associates with the Src-family kinase p53/56Lyn and a 120-kDa phosphoprotein.
7687428 1993 CD19 is a substrate of the antigen receptor-associated protein tyrosine kinase in human B cells.
7682714 1993 Identification of HS1 protein as a major substrate of protein-tyrosine kinase(s) upon B-cell antigen receptor-mediated signaling.
7682059 1993 In vitro tyrosine phosphorylation of PLC-gamma 1 and PLC-gamma 2 by src-family protein tyrosine kinases.
7650013 1995 G protein-coupled chemoattractant receptors regulate Lyn tyrosine kinase.Shc adapter protein signaling complexes.
7636265 1995 Association between Lyn protein tyrosine kinase (p53/56lyn) and the beta subunit of the granulocyte-macrophage colony-stimulating factor (GM-CSF) receptors in a GM-CSF-dependent human megakaryocytic leukemia cell line (M-07e).
7612892 1995 Signal transduction through the conserved motifs of the high affinity IgE receptor Fc epsilon RI.
7589101 1995 Specific binding of Fyn and phosphatidylinositol 3-kinase to the B cell surface glycoprotein CD19 through their src homology 2 domains.
7575560 1995 Development of a rapid approach to identification of tyrosine phosphorylation sites: application to PKC delta phosphorylated upon activation of the high affinity receptor for IgE in rat basophilic leukemia cells.
7568175 1995 Membrane-associated CD19-LYN complex is an endogenous p53-independent and Bc1-2-independent regulator of apoptosis in human B-lineage lymphoma cells.
7545683 1995 Association of 75/80-kDa phosphoproteins and the tyrosine kinases Lyn, Fyn, and Lck with the B cell molecule CD20. Evidence against involvement of the cytoplasmic regions of CD20.
7528770 1995 Different roles for the Fc epsilon RI gamma chain as a function of the receptor context.
7526393 1994 Transphosphorylation as the mechanism by which the high-affinity receptor for IgE is phosphorylated upon aggregation.
7516469 1994 Identification of Src, Fyn, and Lyn SH3-binding proteins: implications for a function of SH3 domains.
7515933 1994 Activation of src family kinases in human pre-B cells by IL-7.
3561390 1987 The yes-related cellular gene lyn encodes a possible tyrosine kinase similar to p56lck.
2505253 1989 Selective expression of a protein-tyrosine kinase, p56lyn, in hematopoietic cells and association with production of human T-cell lymphotropic virus type I.
2247464 1990 Putative tyrosine kinases expressed in K-562 human leukemia cells.
2065070 1991 Three regions of erythrocyte band 3 protein are phosphorylated on tyrosines: characterization of the phosphorylation sites by solid phase sequencing combined with capillary electrophoresis.
1998697 1991 Phosphorylation sites in human erythrocyte band 3 protein.
1722201 1991 CSK: a protein-tyrosine kinase involved in regulation of src family kinases.
1720539 1991 Two additional protein-tyrosine kinases expressed in human lung: fourth member of the fibroblast growth factor receptor family and an intracellular protein-tyrosine kinase.
1715582 1991 Membrane glycoprotein IV (CD36) is physically associated with the Fyn, Lyn, and Yes protein-tyrosine kinases in human platelets.
1689310 1990 Tyrosine residues in bovine phospholipase C-gamma phosphorylated by the epidermal growth factor receptor in vitro.
1602151 1992 Treatment of Haemophilus aphrophilus endocarditis with ciprofloxacin.
1557373 1992 Interleukin 2 regulates the activity of the lyn protein-tyrosine kinase in a B-cell line.
1544885 1992 p21rasGAP association with Fyn, Lyn, and Yes in thrombin-activated platelets.
1510669 1992 Expression of the B cell-associated tyrosine kinase gene Lyn in primary neuroblastoma tumours and its modulation during the differentiation of neuroblastoma cell lines.
1508184 1992 Characterization of the promoter region of the src family gene lyn and its trans activation by human T-cell leukemia virus type I-encoded p40tax.
1381360 1992 Steel factor stimulates the tyrosine phosphorylation of the proto-oncogene product, p95vav, in human hemopoietic cells.