Property Summary

NCBI Gene PubMed Count 8
PubMed Score 4.87
PubTator Score 3.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Salmonellosis 42 4.182 2.1

Expression

Gene RIF (2)

AA Sequence

MLSSVVFWGLIALIGTSRGSYPFSHSMKPHLHPRLYHGCYGDIMTMKTSGATCDANSVMNCGIRGSEMFA      1 - 70
EMDLRAIKPYQTLIKEVGQRHCVDPAVIAAIISRESHGGSVLQDGWDHRGLKFGLMQLDKQTYHPVGAWD     71 - 140
SKEHLSQATGILTERIKAIQKKFPTWSVAQHLKGGLSAFKSGIEAIATPSDIDNDFVNDIIARAKFYKRQ    141 - 210
SF                                                                        211 - 212
//

Text Mined References (8)

PMID Year Title