Property Summary

NCBI Gene PubMed Count 28
PubMed Score 41.91
PubTator Score 24.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
cutaneous lupus erythematosus 2.100 4.5e-03
osteosarcoma -3.386 4.4e-07
periodontitis 1.100 1.9e-21
atypical teratoid / rhabdoid tumor 1.200 2.1e-03
medulloblastoma, large-cell 1.400 5.0e-05
interstitial cystitis 2.100 2.4e-03
adult high grade glioma 1.100 8.7e-03
ulcerative colitis 1.100 5.1e-04
ovarian cancer 1.300 2.7e-07
dermatomyositis -1.100 6.5e-04

Gene RIF (16)

PMID Text
26303094 CD229 Expression on Bone Marrow Plasma Cells from Patients with Multiple Myeloma and Monoclonal Gammopathies of Uncertain Significance.
26221972 the Val602 variant of the non-synonymous single nucleotide polymorphism (SNP) rs509749 in the SLAM family member CD229 (Ly9, SLAMF3) has a two-fold lower affinity compared with the SLE-associated Met602 variant for the small adaptor protein SAP
26001047 study showed CD229 is overexpressed on the malignant plasma cells of patients across all types of plasma cell dyscrasias including multiple myeloma; CD229 is also expressed on the surface of a fraction of cells carrying the phenotype of chemotherapy-resistant and myeloma-propagating cells within the patients' bone marrow
24927415 Results revealed that SLAMF3 plays a role during hepatitis C virus entry, likely by enhancing entry of viral particle within hepatocytes.
24376606 SLAMF3 is an inhibitor of hepatocellular carcinoma cell proliferation and tumor progression.
24162774 HIV-1 gp120 downregulates the expression of lymphocyte antigen 9 (LY9) in human B cells
23956418 These results suggest a role for CD319 and CD229 in the systemic lupus erythematosus disease process.
22989874 Data indicate that the dominance of the SLAMF3/SLAMF6 pathway in inducing IL-17A production can be attributed to an increased nuclear abundance and recruitment of RORgammat to the IL17A promoter.
22184727 SLAMF3 and SLAMF6 T cell surface expression and IL-17 levels significantly correlate with disease activity in systemic lupus erythematosus patients
21606160 CD229 is specifically over-expressed on myeloma cells including their clonogenic precursors and contributes to their malignant phenotype.
20237496 Observational study of gene-disease association. (HuGE Navigator)
18216865 A family-based association study in the United Kingdom and Canada identifies genetic variants in the LY9 promoter and coding region contributing to systemic lupus erythematosus susceptibility.
18216865 Observational study of gene-disease association. (HuGE Navigator)
15905546 CD229 is a self-ligand, interacting through its N-terminal V-like domain which contains three amino acid residues critical for the homophilic binding interaction.
15879090 CD229, but not other members of the CD150 family, directly bind Grb2.
12242590 Both mouse and human novel Ly9 genes mapped close to the CD229 gene in a region where other members of the CD150 family have also been mapped.

AA Sequence

MVAPKSHTDDWAPGPFSSKPQRSQLQIFSSVLQTSLLFLLMGLRASGKDSAPTVVSGILGGSVTLPLNIS      1 - 70
VDTEIENVIWIGPKNALAFARPKENVTIMVKSYLGRLDITKWSYSLCISNLTLNDAGSYKAQINQRNFEV     71 - 140
TTEEEFTLFVYEQLQEPQVTMKSVKVSENFSCNITLMCSVKGAEKSVLYSWTPREPHASESNGGSILTVS    141 - 210
RTPCDPDLPYICTAQNPVSQRSSLPVHVGQFCTDPGASRGGTTGETVVGVLGEPVTLPLALPACRDTEKV    211 - 280
VWLFNTSIISKEREEAATADPLIKSRDPYKNRVWVSSQDCSLKISQLKIEDAGPYHAYVCSEASSVTSMT    281 - 350
HVTLLIYRRLRKPKITWSLRHSEDGICRISLTCSVEDGGNTVMYTWTPLQKEAVVSQGESHLNVSWRSSE    351 - 420
NHPNLTCTASNPVSRSSHQFLSENICSGPERNTKLWIGLFLMVCLLCVGIFSWCIWKRKGRCSVPAFCSS    421 - 490
QAEAPADTPEPTAGHTLYSVLSQGYEKLDTPLRPARQQPTPTSDSSSDSNLTTEEDEDRPEVHKPISGRY    491 - 560
EVFDQVTQEGAGHDPAPEGQADYDPVTPYVTEVESVVGENTMYAQVFNLQGKTPVSQKEESSATIYCSIR    561 - 630
KPQVVPPPQQNDLEIPESPTYENFT                                                 631 - 655
//

Text Mined References (32)

PMID Year Title
26303094 2016 CD229 Expression on Bone Marrow Plasma Cells from Patients with Multiple Myeloma and Monoclonal Gammopathies of Uncertain Significance.
26221972 2015 A polymorphism in a phosphotyrosine signalling motif of CD229 (Ly9, SLAMF3) alters SH2 domain binding and T-cell activation.
26001047 2015 CD229 is expressed on the surface of plasma cells carrying an aberrant phenotype and chemotherapy-resistant precursor cells in multiple myeloma.
24927415 2014 The expression of the hepatocyte SLAMF3 (CD229) receptor enhances the hepatitis C virus infection.
24376606 2013 Identification of SLAMF3 (CD229) as an inhibitor of hepatocellular carcinoma cell proliferation and tumour progression.
23956418 2013 Systemic lupus erythematosus immune complexes increase the expression of SLAM family members CD319 (CRACC) and CD229 (LY-9) on plasmacytoid dendritic cells and CD319 on CD56(dim) NK cells.
22989874 2012 CD3-T cell receptor co-stimulation through SLAMF3 and SLAMF6 receptors enhances ROR?t recruitment to the IL17A promoter in human T lymphocytes.
22184727 2012 Increased expression of SLAM receptors SLAMF3 and SLAMF6 in systemic lupus erythematosus T lymphocytes promotes Th17 differentiation.
21606160 2011 Surface molecule CD229 as a novel target for the diagnosis and treatment of multiple myeloma.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19349973 2009 Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins.
18216865 2008 Association of LY9 in UK and Canadian SLE families.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16365421 2006 Ly9 (CD229)-deficient mice exhibit T cell defects yet do not share several phenotypic characteristics associated with SLAM- and SAP-deficient mice.
15905546 2005 CD229 (Ly9) lymphocyte cell surface receptor interacts homophilically through its N-terminal domain and relocalizes to the immunological synapse.
15879090 2005 Identification of Grb2 as a novel binding partner of the signaling lymphocytic activation molecule-associated protein binding receptor CD229.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12621057 2003 The cell surface expression of SAP-binding receptor CD229 is regulated via its interaction with clathrin-associated adaptor complex 2 (AP-2).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12458214 2003 Dual functional roles for the X-linked lymphoproliferative syndrome gene product SAP/SH2D1A in signaling through the signaling lymphocyte activation molecule (SLAM) family of immune receptors.
12242590 2002 Mouse novel Ly9: a new member of the expanding CD150 (SLAM) family of leukocyte cell-surface receptors.
11689425 2001 Structural basis for the interaction of the free SH2 domain EAT-2 with SLAM receptors in hematopoietic cells.
11477068 2001 Characterization of SH2D1A missense mutations identified in X-linked lymphoproliferative disease patients.
11389028 2001 Cell surface receptors Ly-9 and CD84 recruit the X-linked lymphoproliferative disease gene product SAP.
11369645 2001 Molecular characterization and expression of a novel human leukocyte cell-surface marker homologous to mouse Ly-9.
10970093 2000 Gene structure of the mouse leukocyte cell surface molecule Ly9.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.
8537117 1996 Isolation and characterization of cDNA clones for Humly9: the human homologue of mouse Ly9.
7797269 1995 Physical and genetic linkage of the genes encoding Ly-9 and CD48 on mouse and human chromosomes 1.