Property Summary

NCBI Gene PubMed Count 4
PubMed Score 6.31
PubTator Score 1.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7933 3.0e-08

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -2.425 3.0e-08

Synonym

Accession Q5SRR4 A6NCW4 B0UXB3 B0UXB4 B0UZ69 B0UZQ0 B1B0L9 O95871 Q5SQ59 Q8NDY0 Q8NDY1
Symbols G5C
NG33
C6orf20
LY6G5CA
LY6G5CB

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

PMID Text
19851445 Observational study of gene-disease association. (HuGE Navigator)
18835879 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MRFMAGPAGSQSLGPLCFHSSPQALYTVLLIVLVMMSLVFGKFVPVNWEPPQPLPFPKYLRCYRCLLETK      1 - 70
ELGCLLGSDICLTPAGSSCITLHKKNSSGSDVMVSDCRSKEQMSDCSNTRTSPVSGFWIFSQYCFLDFCN     71 - 140
DPQNRGLYTP                                                                141 - 150
//

Text Mined References (7)

PMID Year Title
19851445 2009 High-density SNP screening of the major histocompatibility complex in systemic lupus erythematosus demonstrates strong evidence for independent susceptibility regions.
18835879 2008 Fine mapping of the MHC Class III region demonstrates association of AIF1 and rheumatoid arthritis.
17192395 2007 Comparative gene expression profiling of in vitro differentiated megakaryocytes and erythroblasts identifies novel activatory and inhibitory platelet membrane proteins.
17008713 2006 Characterization of the five novel Ly-6 superfamily members encoded in the MHC, and detection of cells expressing their potential ligands.
14656967 2003 Analysis of the gene-dense major histocompatibility complex class III region and its comparison to mouse.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12079290 2002 Transcriptional analysis of a novel cluster of LY-6 family members in the human and mouse major histocompatibility complex: five genes with many splice forms.