Property Summary

NCBI Gene PubMed Count 5
PubMed Score 6.31
PubTator Score 1.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 3.0e-08

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -2.425 3.0e-08

Gene RIF (2)

AA Sequence

MRFMAGPAGSQSLGPLCFHSSPQALYTVLLIVLVMMSLVFGKFVPVNWEPPQPLPFPKYLRCYRCLLETK      1 - 70
ELGCLLGSDICLTPAGSSCITLHKKNSSGSDVMVSDCRSKEQMSDCSNTRTSPVSGFWIFSQYCFLDFCN     71 - 140
DPQNRGLYTP                                                                141 - 150
//

Text Mined References (7)

PMID Year Title