Property Summary

NCBI Gene PubMed Count 12
PubMed Score 42.75
PubTator Score 42.20

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
esophageal adenocarcinoma -3.800 2.2e-02
pancreatic ductal adenocarcinoma liver m... 1.883 4.3e-02
non-small cell lung cancer 2.418 6.8e-08
pancreatic cancer 1.700 5.7e-03
fibroadenoma 1.800 1.4e-02
lung adenocarcinoma 1.200 1.8e-02
psoriasis 1.200 2.0e-24

Gene RIF (4)

PMID Text
26223706 LY6D is the most highly up-regulated in HTR-8/SVneo-SP cells and it has potential to maintain cell proliferation of the cells. it is important for the maintenance of the cells.
23672314 E48 expression was strong and diffuse in non-neoplastic squamous epithelium, and decreased with progression to laryngeal squamous cell carcinoma. Poorly differentiated tumors had fewer E48-positive cells than well- to moderately- differentiated cases.
23075424 induction of LY6D expression is triggered through a pathway regulated by ATM, CHK2 and p53
18187620 Knockdown of lymphocyte antigen 6 complex, locus D (LY6D) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells

AA Sequence

MRTALLLLAALAVATGPALTLRCHVCTSSSNCKHSVVCPASSRFCKTTNTVEPLRGNLVKKDCAESCTPS      1 - 70
YTLQGQVSSGTSSTQCCQEDLCNEKLHNAAPTRTALAHSALSLGLALSLLAVILAPSL                 71 - 128
//

Text Mined References (13)

PMID Year Title
26223706 2016 Up-regulation of lymphocyte antigen 6 complex expression in side-population cells derived from a human trophoblast cell line HTR-8/SVneo.
23672314 2013 Expression of Ep-CAM, but not of E48, associates with nodal involvement in advanced squamous cell carcinomas of the larynx.
23075424 2012 Expression of LY6D is induced at the surface of MCF10A cells by X-ray irradiation.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9551972 1998 Characterization and mapping to human chromosome 8q24.3 of Ly-6-related gene 9804 encoding an apparent homologue of mouse TSA-1.
9366413 1997 A gain of novel tissue specificity in the human Ly-6 gene E48.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
7790363 1995 The human E48 antigen, highly homologous to the murine Ly-6 antigen ThB, is a GPI-anchored molecule apparently involved in keratinocyte cell-cell adhesion.