Property Summary

NCBI Gene PubMed Count 10
PubMed Score 4.08
PubTator Score 0.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
gastric cancer -1.300 3.1e-04
pancreatic cancer -1.100 4.8e-03
osteosarcoma 2.345 4.5e-05
ependymoma -1.300 5.6e-12
glioblastoma -1.200 4.5e-04
medulloblastoma -1.400 1.1e-04
atypical teratoid / rhabdoid tumor -1.200 5.8e-06
medulloblastoma, large-cell -1.600 1.1e-02
primitive neuroectodermal tumor -1.400 3.6e-03
intraductal papillary-mucinous carcinoma... 1.600 2.6e-03
intraductal papillary-mucinous neoplasm ... 1.200 3.6e-02
lung cancer -1.400 1.7e-02
adult high grade glioma -1.300 5.4e-04
pilocytic astrocytoma -1.100 4.9e-06
pancreatic carcinoma -1.100 4.8e-03
acute myeloid leukemia 1.800 2.2e-02
ovarian cancer 3.000 2.8e-07
pituitary cancer 1.100 7.3e-06
head and neck cancer and chronic obstruc... -1.100 1.6e-02

AA Sequence

MAEFTSYKETASSRHLRFKLQSLSRRLDELEEATKNLQKAEDELLDLQDKVIQAEGSNSSMLAEIEVLRQ      1 - 70
RVLRIEGKDEEIKRAEDLCRLMKEKLEEEENLTRELKSEIERLQKRMAELEKLEEAFSRSKNDCTQLCLS     71 - 140
LNEERNLTKKISSELEMLRVKVKELESSEDRLDKTEQSLASELEKLKSLTLSFVSERKYLNEKEKENEKL    141 - 210
IKELTQKLEQNKKMNRDYTRNASNLERNDLRIEDGISSTLPSKESRRKGGLDYLKQVENETRNKSENEKN    211 - 280
RNQEDNKVKDLNQEIEKLKTQIKHFESLEEELKKMKSKNNDLQDNYLSEQNKNKLLASQLEEIKLQIKKQ    281 - 350
KELENGEVEGEDAFLSSKGRHERTKFRGHGSEASVSKHTARELSPQHKRERLRNREFALNNENYSLSNRQ    351 - 420
VSSPSFTNRRAAKASHMGVSTDSGTQETKKTEDRFVPGSSQSEGKKSREQPSVLSRYPPAAQEHSKAWKG    421 - 490
TSKPGTESGLKGKVEKTTRTFSDTTHGSVPSDPLGRADKASDTSSETVFGKRGHVLGNGSQVTQAANSGC    491 - 560
SKAIGALASSRRSSSEGLSKGKKAANGLEADNSCPNSKAPVLSKYPYSCRSQENILQGFSTSHKEGVNQP    561 - 630
AAVVMEDSSPHEALRCRVIKSSGREKPDSDDDLDIASLVTAKLVNTTITPEPEPKPQPNSREKAKTRGAP    631 - 700
RTSLFENDKDAGMENESVKSVRASTNTMELPDTNGAGVKSQRPFSPREALRSRAIIKPVIVDKDVKKIMG    701 - 770
GSGTETTLEKQKPVSKPGPNKVTSSITIYPSDSSSPRAAPGEALRERHTSTSNIQVGLAELTSVSNHVSS    771 - 840
PFELSIHKHDITLQLAEAERMADGPLKDRPETVVSRSSIIIKPSDPVERNSHAPPAETIRWKSHSAPSEV    841 - 910
GFSDARHVTVRNAWKSRRDLKSLEDPPTRIGKNVESTNSNAYTQRSSTDFSELEQPRSCLFEQGTRRVGP    911 - 980
SSGDAPEPSSRRTQSSLTVSEVLTRRNRVGDTITVAAWNHSASMEEEGEDCTLSVYRQLHNSLDPSELPG    981 - 1050
KQGLPESGRVRAEERLRPTRPCAEEN                                               1051 - 1076
//

Text Mined References (17)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18570454 2008 Proteomic analysis of exosomes from human neural stem cells by flow field-flow fractionation and nanoflow liquid chromatography-tandem mass spectrometry.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12693554 2003 Characterization of long cDNA clones from human adult spleen. II. The complete sequences of 81 cDNA clones.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8812416 1996 Identification, molecular characterization, and chromosomal localization of the cDNA encoding a novel leucine zipper motif-containing protein.