Property Summary

NCBI Gene PubMed Count 11
PubMed Score 4.08
PubTator Score 0.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
acute myeloid leukemia 1.800 2.2e-02
adult high grade glioma -1.300 5.4e-04
Astrocytoma, Pilocytic -1.100 6.3e-06
atypical teratoid / rhabdoid tumor -1.200 5.8e-06
ependymoma -1.300 5.6e-12
gastric cancer -1.300 3.1e-04
glioblastoma -1.100 1.2e-05
group 4 medulloblastoma -1.200 2.7e-04
head and neck cancer and chronic obstruc... -1.100 1.6e-02
intraductal papillary-mucinous carcinoma... 1.600 2.6e-03
intraductal papillary-mucinous neoplasm ... 1.200 3.6e-02
lung cancer -1.400 1.7e-02
medulloblastoma, large-cell -1.600 1.1e-02
osteosarcoma 2.345 4.5e-05
ovarian cancer 3.000 2.8e-07
pancreatic cancer -1.100 4.8e-03
pancreatic carcinoma -1.100 4.8e-03
pituitary cancer 1.100 7.3e-06
primitive neuroectodermal tumor -1.400 3.6e-03

Gene RIF (1)

AA Sequence

MAEFTSYKETASSRHLRFKLQSLSRRLDELEEATKNLQKAEDELLDLQDKVIQAEGSNSSMLAEIEVLRQ      1 - 70
RVLRIEGKDEEIKRAEDLCRLMKEKLEEEENLTRELKSEIERLQKRMAELEKLEEAFSRSKNDCTQLCLS     71 - 140
LNEERNLTKKISSELEMLRVKVKELESSEDRLDKTEQSLASELEKLKSLTLSFVSERKYLNEKEKENEKL    141 - 210
IKELTQKLEQNKKMNRDYTRNASNLERNDLRIEDGISSTLPSKESRRKGGLDYLKQVENETRNKSENEKN    211 - 280
RNQEDNKVKDLNQEIEKLKTQIKHFESLEEELKKMKSKNNDLQDNYLSEQNKNKLLASQLEEIKLQIKKQ    281 - 350
KELENGEVEGEDAFLSSKGRHERTKFRGHGSEASVSKHTARELSPQHKRERLRNREFALNNENYSLSNRQ    351 - 420
VSSPSFTNRRAAKASHMGVSTDSGTQETKKTEDRFVPGSSQSEGKKSREQPSVLSRYPPAAQEHSKAWKG    421 - 490
TSKPGTESGLKGKVEKTTRTFSDTTHGSVPSDPLGRADKASDTSSETVFGKRGHVLGNGSQVTQAANSGC    491 - 560
SKAIGALASSRRSSSEGLSKGKKAANGLEADNSCPNSKAPVLSKYPYSCRSQENILQGFSTSHKEGVNQP    561 - 630
AAVVMEDSSPHEALRCRVIKSSGREKPDSDDDLDIASLVTAKLVNTTITPEPEPKPQPNSREKAKTRGAP    631 - 700
RTSLFENDKDAGMENESVKSVRASTNTMELPDTNGAGVKSQRPFSPREALRSRAIIKPVIVDKDVKKIMG    701 - 770
GSGTETTLEKQKPVSKPGPNKVTSSITIYPSDSSSPRAAPGEALRERHTSTSNIQVGLAELTSVSNHVSS    771 - 840
PFELSIHKHDITLQLAEAERMADGPLKDRPETVVSRSSIIIKPSDPVERNSHAPPAETIRWKSHSAPSEV    841 - 910
GFSDARHVTVRNAWKSRRDLKSLEDPPTRIGKNVESTNSNAYTQRSSTDFSELEQPRSCLFEQGTRRVGP    911 - 980
SSGDAPEPSSRRTQSSLTVSEVLTRRNRVGDTITVAAWNHSASMEEEGEDCTLSVYRQLHNSLDPSELPG    981 - 1050
KQGLPESGRVRAEERLRPTRPCAEEN                                               1051 - 1076
//

Text Mined References (18)

PMID Year Title