Property Summary

NCBI Gene PubMed Count 83
PubMed Score 509.36
PubTator Score 108.21

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
lung carcinoma 2844 1.4e-22
juvenile dermatomyositis 1189 1.1e-10
Duchenne muscular dystrophy 602 3.5e-09
sonic hedgehog group medulloblastoma 1482 1.3e-07
malignant mesothelioma 3163 9.7e-07
cystic fibrosis 1670 1.1e-06
primary pancreatic ductal adenocarcinoma 1271 5.0e-06
ulcerative colitis 2087 5.3e-06
Breast cancer 3098 6.0e-06
pancreatic cancer 2300 3.7e-05
primary Sjogren syndrome 788 1.1e-04
limb girdle muscular dystrophy 2A 156 2.3e-04
lung cancer 4473 2.5e-04
pilocytic astrocytoma 3086 4.0e-04
ovarian cancer 8491 9.1e-04
posterior fossa group A ependymoma 1511 9.3e-04
fascioscapulohumeral muscular dystrophy 100 2.2e-03
subependymal giant cell astrocytoma 2287 2.5e-03
pituitary cancer 1972 2.7e-03
adrenocortical carcinoma 1427 4.7e-03
intraductal papillary-mucinous adenoma (IPMA) 2956 6.6e-03
osteosarcoma 7933 7.2e-03
gastric carcinoma 832 8.0e-03
urothelial carcinoma 318 8.5e-03
intraductal papillary-mucinous carcinoma (IPMC) 2988 8.6e-03
Amyotrophic Lateral Sclerosis 432 9.1e-03
acute quadriplegic myopathy 1157 9.4e-03
medulloblastoma, large-cell 6234 1.1e-02
head and neck cancer and chronic obstructive pulmonary disease 237 1.3e-02
glioblastoma 5572 1.3e-02
pediatric high grade glioma 2712 1.3e-02
adrenocortical adenoma 134 1.5e-02
diabetes mellitus 1663 1.8e-02
nasopharyngeal carcinoma 1056 1.8e-02
esophageal adenocarcinoma 737 1.9e-02
autosomal dominant Emery-Dreifuss muscular dystrophy 499 2.0e-02
aldosterone-producing adenoma 664 2.1e-02
hereditary spastic paraplegia 313 4.8e-02

Expression

  Differential Expression (38)

Disease log2 FC p
urothelial carcinoma 2.900 8.5e-03
malignant mesothelioma -1.800 9.7e-07
esophageal adenocarcinoma 2.100 1.9e-02
glioblastoma 3.200 1.3e-02
osteosarcoma 1.836 7.2e-03
sonic hedgehog group medulloblastoma 3.600 1.3e-07
cystic fibrosis -2.286 1.1e-06
medulloblastoma, large-cell 2.100 1.1e-02
Duchenne muscular dystrophy 2.995 3.5e-09
limb girdle muscular dystrophy 2A 2.041 2.3e-04
autosomal dominant Emery-Dreifuss muscul... 1.878 2.0e-02
fascioscapulohumeral muscular dystrophy 1.339 2.2e-03
hereditary spastic paraplegia -1.265 4.8e-02
juvenile dermatomyositis 2.372 1.1e-10
Amyotrophic Lateral Sclerosis 1.035 9.1e-03
acute quadriplegic myopathy 1.626 9.4e-03
adrenocortical adenoma -1.554 1.5e-02
adrenocortical carcinoma -2.952 4.7e-03
primary pancreatic ductal adenocarcinoma 3.306 5.0e-06
intraductal papillary-mucinous adenoma (... -2.600 6.6e-03
intraductal papillary-mucinous carcinoma... -3.100 8.6e-03
lung cancer -1.400 2.5e-04
diabetes mellitus -1.700 1.8e-02
pediatric high grade glioma 1.500 1.3e-02
pilocytic astrocytoma 2.100 4.0e-04
posterior fossa group A ependymoma 1.900 9.3e-04
primary Sjogren syndrome 1.900 1.1e-04
aldosterone-producing adenoma -1.204 2.1e-02
subependymal giant cell astrocytoma 6.984 2.5e-03
nasopharyngeal carcinoma 1.200 1.8e-02
lung carcinoma -3.600 1.4e-22
Breast cancer 2.100 6.0e-06
gastric carcinoma 2.600 8.0e-03
ulcerative colitis 3.500 5.3e-06
ovarian cancer -3.700 9.1e-04
pituitary cancer -2.000 2.7e-03
pancreatic cancer 2.900 3.7e-05
head and neck cancer and chronic obstruc... 1.100 1.3e-02

Gene RIF (64)

PMID Text
26351669 fibroblasts stimulated with the fibrocyte-secreted inflammatory signal tumor necrosis factor-alpha secrete the small leucine-rich proteoglycan lumican.
25304290 Lumican, decorin and dermatopontin are differentially expressed and may serve as biomarkers for metastatic and recurrent Giant cell tumor of bone
24956166 This meta-analysis suggests that LUM polymorphisms are associated with the risk of high myopia.
24927138 This meta-analysis has suggested that there is a lack of association of the rs3759223 polymorphism with high myopia risk.
24804215 Extracellular matrix proteins expression profiling in chemoresistant variants of the A2780 ovarian cancer cell line.
24552666 The results suggest that regions within LUM is associated with ACL injury susceptibility and that genetic sequence variability within genes encoding proteoglycans may potentially modulate the ligament fibril properties.
24516061 meta-analysis, including 1,545 subjects from 5 studies, indicated that Chinese lumican rs3759223 C allele carriers had a decreased risk of high myopia in comparison to T allele carriers
24367547 Lumican binds ALK5 to promote epithelium wound healing
24061151 This meta-analysis showed the evidence that SNP rs3759223 may affect individual susceptibility to high myopia in the Chinese population.
23846574 lumican may be involved in cell growth and invasion through the regulation of 24 proteins expressed in pancreatic ductal adenocarcinoma.
23747391 Both lumican and decorin are involved in collagen fibrillogenesis and stability.
23719483 These findings suggest that lumican plays an important role in the pathogenesis of Bowen disease and actinic keratosis
23656908 These findings suggest that lumican is a potent differential diagnostic marker that distinguishes hidroacanthoma simplex from clonal-type seborrheic keratosis.
23643269 Lumican gene can promote the proliferation of lung adenocarcinoma cell A549, and its mechanism may be related to increased RhoC and p-Akt protein expressions.
23480731 Cardiac levels of lumican is increased in experimental and clinical heart failure.
23399832 lumican present in the reactive stroma surrounding prostate primary tumors plays a restrictive role on cancer progression
23145541 The current study did not support an association between the promoter SNPs of the LUM gene with high myopia in the Korean population.
22814255 lumican expression and its presence in ECM has an impact on colon cancer cells motility and may modulate invasiveness of colon cancer.
22809227 Our results confirm that the PAX6, Lumican, and MYOC genes were not associated with high myopia in the Han Chinese in Northeastern China.
22721676 LUM in combination with other known markers, such as CRP, could be evaluated as a panel of biomarkers of POAD.
22711178 Lack of Lumican expression is associated with recurrence in colon cancer.
22441960 The reduction in keratan sulfate levels and the strong correlation between chondroitin 6-sulfate and keratan sulfate levels indi-cates suppressed cartilage turnover after arthroscopic surgery.
22228989 Lumican may be a potential acute aortic dissection (AAD)-related serum marker that may assist the diagnosis of AAD.
22073367 lumican and fibromodulin display different behaviors and that lumican may promote regeneration of the TMJ after degeneration and deformation induced by IL-1 beta.
21885486 Single nucleotide polymorphisms in lumican gene are associated with systemic lupus erythematosus in the Taiwan Chinese Han population.
21421073 regulates osteosarcoma cell adhesion by modulating TGFbeta2 activity
20819773 lumican may play a key role in the generation of a new collagen network by fibroblast-like cells
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20360993 Observational study of gene-disease association. (HuGE Navigator)
20357198 Linkage and haplotype analyses identified 12q21.33 as a locus for posterior amorphous corneal dystrophy. However, no mutations were identified in the candidate genes (KERA, LUM, DCN, EPYC) within this region.
20138170 lumican protein plays important roles in the inhibition of HEK cell attachment and growth, and it might inhibit the activation of integrin pathways
20010793 four polymorphisms of the LUM promoter contribute to the pathogenesis of high myopia.
20010793 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19843670 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19686741 determined the active sequence of the lumican core protein responsible for the inhibition of melanoma cell migration
19643966 These observations suggest that LUM gene polymorphisms contribute to the development of high myopia.
19643966 Observational study of gene-disease association. (HuGE Navigator)
19616852 Genetic variation in the regulatory domains of the lumican gene, where both rs3759223 and rs3741834 are located, are associated with high myopia susceptibility among the Han Chinese.
19616852 Observational study of gene-disease association. (HuGE Navigator)
19569180 Data suggest that five novel genes, LUM, PDE3B, PDGF-C, NRG1 and PKD2, have great potential for predicting the efficacy of cisplatin-based chemotherapy against OSCC.
19394140 the cytoskeleton remodeling and the decreased pFAK phosphorylation induced by lumican in melanoma cells might explain, at least in part, the anti-invasive effect of lumincan
19330863 Histologically progressive nonalcoholic fatty liver disease is associated with overexpression of lumican.
19060265 The study does not support the association of high myopia with alleles of rs2229336 in TGIF, rs3759223 in lumican, rs1982073 in TGFB1, and rs3735520 in HGF.
19060265 Observational study of gene-disease association. (HuGE Navigator)
19036156 Genetic variation in lumican gene is associated with breast cancer.
19020750 Expression and roles of lumican in lung adenocarcinoma and squamous cell carcinoma.
19012040 the transcripts upregulated according to disease progression were associated with signaling pathway/transcription, including tumor-associated calcium signal transducer 1 and chemokine ligand 19, and with cell communication, such as collagen.
19008226 Homologous sequence in lumican and fibromodulin leucine-rich repeat 5-7 competes for collagen binding.
18620607 Multiple core-protein species were detected for decorin, biglycan, lumican and keratocan in the degenerate osteoarthritic articular cartilage and menisci.
18477477 Lumican induces cell migration by activating ERK 1/2 signaling and ERK 1/2 stimulates expression of integrin beta1.
18093185 lumican expression may be positively correlated with the differentiation and negatively correlated with the progression of osteosarcoma
17671699 Lumican expression in stromal tissues plays an important role in the growth and invasion of pancreatic cancer.
17558846 In addition, no pathogenic sequence variations were found in DCN, DSPG3, LUM, PITX2 and FOXC1, which have also been implicated in corneal and anterior segment dysgenesis.
17050378 metastatic melanoma cell lines were found to express lumican mRNA and effectively secrete lumican in a proteoglycan form, characterized to be substituted mostly with keratan sulfate chains; lumican mRNA was not detected in normal melanocytes
16902402 Observational study of gene-disease association. (HuGE Navigator)
16902402 An SNP (rs3759223), which is located in the promoter region of the lumican gene, may be worth further investigation to determine its association with development of high myopia.
16760896 No evidence that endothelial dysfunction and germline mutation of lumican and keratocan genes participate in the etiology of subepithelial corneal haze.
15336555 Malignant cells can actively influence the composition of the extracellular matrix through TGFbeta1 and other soluble factors.
15149859 studies of lumican-transfected melanoma cells suggest that lumican is involved in the control melanoma growth and invasion and may be considered, like decorin, as an anti-tumor factor from the extracellular matrix
14996436 Inverse regulation in the expression of endoglin and lumican.
14720136 Lumican protein has an inhibitory effect on HEK 293 cell growth in vitro.
12366811 the lumican protein synthesized by cancer cells, fibroblasts and epithelial cells with mild reactive dysplasia found adjacent to cancer cells may affect the growth of human colorectal cancer cells.
11956587 Expression and accumulation of lumican protein in uterine cervical cancer

AA Sequence

MSLSAFTLFLALIGGTSGQYYDYDFPLSIYGQSSPNCAPECNCPESYPSAMYCDELKLKSVPMVPPGIKY      1 - 70
LYLRNNQIDHIDEKAFENVTDLQWLILDHNLLENSKIKGRVFSKLKQLKKLHINHNNLTESVGPLPKSLE     71 - 140
DLQLTHNKITKLGSFEGLVNLTFIHLQHNRLKEDAVSAAFKGLKSLEYLDLSFNQIARLPSGLPVSLLTL    141 - 210
YLDNNKISNIPDEYFKRFNALQYLRLSHNELADSGIPGNSFNVSSLVELDLSYNKLKNIPTVNENLENYY    211 - 280
LEVNQLEKFDIKSFCKILGPLSYSKIKHLRLDGNRISETSLPPDMYECLRVANEVTLN                281 - 338
//

Text Mined References (88)

PMID Year Title
26351669 2015 TNF-?-stimulated fibroblasts secrete lumican to promote fibrocyte differentiation.
25304424 2014 Lumican: a new inhibitor of matrix metalloproteinase-14 activity.
25304290 2014 Gene expression profiling of giant cell tumor of bone reveals downregulation of extracellular matrix components decorin and lumican associated with lung metastasis.
24956166 2014 Meta-analysis of the association between lumican gene polymorphisms and susceptibility to high Myopia.
24927138 2014 Lack of association between LUM rs3759223 polymorphism and high myopia.
24804215 2014 Extracellular matrix proteins expression profiling in chemoresistant variants of the A2780 ovarian cancer cell line.
24552666 2014 Genes encoding proteoglycans are associated with the risk of anterior cruciate ligament ruptures.
24516061 2014 Association between a lumican promoter polymorphism and high myopia in the Chinese population: a meta-analysis of case-control studies.
24376456 2013 Gene-alcohol interactions identify several novel blood pressure loci including a promising locus near SLC16A9.
24367547 2013 Lumican binds ALK5 to promote epithelium wound healing.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24061151 2013 Association of Lumican gene polymorphism with high myopia: a meta-analysis.
23846574 2013 Analysis of protein expression regulated by lumican in PANC?1 cells using shotgun proteomics.
23747391 2013 Quantitative analysis of type I collagen fibril regulation by lumican and decorin using AFM.
23719483 2013 Lumican as a novel marker for differential diagnosis of Bowen disease and actinic keratosis.
23656908 2014 Expression of lumican in hidroacanthoma simplex and clonal-type seborrheic keratosis as a potent differential diagnostic marker.
23643269 2013 [Effect of lumican gene over-expression on proliferation of lung adenocarcinoma cell A549 and its mechanism].
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23480731 2013 Lumican is increased in experimental and clinical heart failure, and its production by cardiac fibroblasts is induced by mechanical and proinflammatory stimuli.
23399832 2013 Lumican expression, localization and antitumor activity in prostate cancer.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23284291 2012 Genome-wide joint meta-analysis of SNP and SNP-by-smoking interaction identifies novel loci for pulmonary function.
23145541 Absence of an association between lumican promoter variants and high myopia in the Korean population.
22814255 2012 Overexpression of lumican affects the migration of human colon cancer cells through up-regulation of gelsolin and filamentous actin reorganization.
22809227 2012 Ten SNPs of PAX6, Lumican, and MYOC genes are not associated with high myopia in Han Chinese.
22721676 Assessment of gene expression profiles in peripheral occlusive arterial disease.
22711178 2013 Lumican and versican are associated with good outcome in stage II and III colon cancer.
22441960 2013 Changes in synovial fluid biochemical markers following arthroscopic surgery in patients with knee osteoarthritis.
22261194 2012 Proteomics analysis of cardiac extracellular matrix remodeling in a porcine model of ischemia/reperfusion injury.
22228989 2011 Quantitative proteomics analysis by isobaric tags for relative and absolute quantitation identified Lumican as a potential marker for acute aortic dissection.
22073367 2011 Expression of lumican and fibromodulin following interleukin-1 beta stimulation of disc cells of the human temporomandibular joint.
21885486 2011 Association analysis of polymorphisms in lumican gene and systemic lupus erythematosus in a Taiwan Chinese Han population.
21421073 2011 Lumican regulates osteosarcoma cell adhesion by modulating TGF?2 activity.
21220648 2011 Resequencing of 29 candidate genes in patients with familial and sporadic amyotrophic lateral sclerosis.
20819773 2010 Expression of lumican in the articular disc of the human temporomandibular joint.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20551380 2010 Proteomics characterization of extracellular space components in the human aorta.
20360993 2010 Candidate gene study to investigate the genetic determinants of normal variation in central corneal thickness.
20357198 2010 Linkage of posterior amorphous corneal dystrophy to chromosome 12q21.33 and exclusion of coding region mutations in KERA, LUM, DCN, and EPYC.
20138170 2010 Enhanced expression of lumican inhibited the attachment and growth of human embryonic kidney 293 cells.
20010793 2010 The association between lumican gene polymorphisms and high myopia.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19843670 2009 Association of breast cancer susceptibility variants with risk of pancreatic cancer.
19686741 2009 Lumcorin: a leucine-rich repeat 9-derived peptide from human lumican inhibiting melanoma cell migration.
19643966 2010 Association of the lumican gene functional 3'-UTR polymorphism with high myopia.
19616852 2009 The association of haplotype at the lumican gene with high myopia susceptibility in Taiwanese patients.
19569180 2010 Identification of cisplatin-resistance related genes in head and neck squamous cell carcinoma.
19394140 2009 Lumican core protein inhibits melanoma cell migration via alterations of focal adhesion complexes.
19330863 2009 Differential expression of lumican and fatty acid binding protein-1: new insights into the histologic spectrum of nonalcoholic fatty liver disease.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19060265 2009 High myopia is not associated with the SNPs in the TGIF, lumican, TGFB1, and HGF genes.
19036156 2008 Genetic variation in stromal proteins decorin and lumican with breast cancer: investigations in two case-control studies.
19020750 2008 Expression and roles of lumican in lung adenocarcinoma and squamous cell carcinoma.
19012040 2008 Intrahepatic gene expression profiles in chronic hepatitis B and autoimmune liver disease.
19008226 2009 Homologous sequence in lumican and fibromodulin leucine-rich repeat 5-7 competes for collagen binding.
18620607 2008 Fragmentation of decorin, biglycan, lumican and keratocan is elevated in degenerate human meniscus, knee and hip articular cartilages compared with age-matched macroscopically normal and control tissues.
18477477 2008 Lumican induces human corneal epithelial cell migration and integrin expression via ERK 1/2 signaling.
18093185 2008 Lumican expression is positively correlated with the differentiation and negatively with the growth of human osteosarcoma cells.
17671699 2007 Role of lumican in cancer cells and adjacent stromal tissues in human pancreatic cancer.
17558846 2007 Autosomal dominant cornea plana is not associated with pathogenic mutations in DCN, DSPG3, FOXC1, KERA, LUM, or PITX2.
17050378 2006 Lumican, a small leucine-rich proteoglycan substituted with keratan sulfate chains is expressed and secreted by human melanoma cells and not normal melanocytes.
16902402 2006 The association of single nucleotide polymorphisms in the 5'-regulatory region of the lumican gene with susceptibility to high myopia in Taiwan.
16760896 2006 The role of lumican and keratocan genes in persistent subepithelial corneal haze following excimer laser photorefractive keratectomy.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
15505028 2004 Interaction of lumican with aggrecan in the aging human sclera.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15466200 2004 Cleavage of lumican by membrane-type matrix metalloproteinase-1 abrogates this proteoglycan-mediated suppression of tumor cell colony formation in soft agar.
15336555 2004 Pancreatic tumor cells influence the composition of the extracellular matrix.
15149859 2004 The small leucine-rich proteoglycan lumican inhibits melanoma progression.
14996436 2004 Lumican is down-regulated in cells expressing endoglin. Evidence for an inverse correlationship between Endoglin and Lumican expression.
14760718 2004 Screening for N-glycosylated proteins by liquid chromatography mass spectrometry.
14720136 2004 Effect of morpholino antisense oligonucleotide against lumican mRNA in human embryonic kidney (HEK) 293 cells.
14718574 2004 The human plasma proteome: a nonredundant list developed by combination of four separate sources.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14551184 2004 Identification of tyrosine sulfation in extracellular leucine-rich repeat proteins using mass spectrometry.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12366811 2002 Expression of lumican in human colorectal cancer cells.
11956587 2002 Expression and accumulation of lumican protein in uterine cervical cancer cells at the periphery of cancer nests.
11016924 2000 Analysis of the human lumican gene promoter.
10892350 2000 Independent modulation of collagen fibrillogenesis by decorin and lumican.
10802664 2000 Mutations in KERA, encoding keratocan, cause cornea plana.
10734230 2000 Fibromodulin and lumican bind to the same region on collagen type I fibrils.
10656267 2000 Super-motifs and evolution of tandem leucine-rich repeats within the small proteoglycans--biglycan, decorin, lumican, fibromodulin, PRELP, keratocan, osteoadherin, epiphycan, and osteoglycin.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.
8595806 1993 Regulation of corneal collagen fibrillogenesis in vitro by corneal proteoglycan (lumican and decorin) core proteins.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7665616 1995 The human lumican gene. Organization, chromosomal location, and expression in articular cartilage.
7558030 1995 Primary structure of human lumican (keratan sulfate proteoglycan) and localization of the gene (LUM) to chromosome 12q21.3-q22.