Property Summary

NCBI Gene PubMed Count 83
PubMed Score 509.36
PubTator Score 108.21

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
lung carcinoma 2844 1.36230994741411E-22
juvenile dermatomyositis 1189 1.08184972766384E-10
Duchenne muscular dystrophy 602 3.53291967227424E-9
sonic hedgehog group medulloblastoma 1482 1.27519261535892E-7
malignant mesothelioma 3163 9.68128025328419E-7
cystic fibrosis 1670 1.09248050176009E-6
primary pancreatic ductal adenocarcinoma 1271 5.03886745379914E-6
ulcerative colitis 2087 5.31805942685402E-6
Breast cancer 3099 6.0110353011256E-6
pancreatic cancer 2300 3.66133012382551E-5
primary Sjogren syndrome 789 1.09886727145739E-4
limb girdle muscular dystrophy 2A 156 2.25933297090487E-4
lung cancer 4473 2.49640318215036E-4
pilocytic astrocytoma 3086 4.01507319424825E-4
ovarian cancer 8492 9.06989379051908E-4
posterior fossa group A ependymoma 1511 9.25022272342914E-4
fascioscapulohumeral muscular dystrophy 100 0.00220672452926646
subependymal giant cell astrocytoma 2287 0.00246186848208726
pituitary cancer 1972 0.00269386155372431
adrenocortical carcinoma 1427 0.00465210580274706
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00662914475476661
osteosarcoma 7933 0.00720127508122372
gastric carcinoma 832 0.00801112655124724
urothelial carcinoma 318 0.00850667515843669
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00859902974715854
Amyotrophic Lateral Sclerosis 432 0.0090958910635893
acute quadriplegic myopathy 1157 0.00939208567838221
medulloblastoma, large-cell 6234 0.0106591720990053
head and neck cancer and chronic obstructive pulmonary disease 237 0.0128947599283815
glioblastoma 5572 0.013161333877909
pediatric high grade glioma 2712 0.0133272704173399
adrenocortical adenoma 134 0.0154544429439152
diabetes mellitus 1663 0.017644258439155
nasopharyngeal carcinoma 1056 0.0179758358126524
esophageal adenocarcinoma 737 0.0190553920760902
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.0198783455121849
aldosterone-producing adenoma 664 0.0207833629243728
hereditary spastic paraplegia 313 0.0484131604186276

Expression

  Differential Expression (38)

Synonym

Accession P51884 B2R6R5 Q96QM7
Symbols LDC
SLRR2D

Gene

LUM

PANTHER Protein Class (1)

  Ortholog (12)

Gene RIF (64)

PMID Text
26351669 fibroblasts stimulated with the fibrocyte-secreted inflammatory signal tumor necrosis factor-alpha secrete the small leucine-rich proteoglycan lumican.
25304290 Lumican, decorin and dermatopontin are differentially expressed and may serve as biomarkers for metastatic and recurrent Giant cell tumor of bone
24956166 This meta-analysis suggests that LUM polymorphisms are associated with the risk of high myopia.
24927138 This meta-analysis has suggested that there is a lack of association of the rs3759223 polymorphism with high myopia risk.
24804215 Extracellular matrix proteins expression profiling in chemoresistant variants of the A2780 ovarian cancer cell line.
24552666 The results suggest that regions within LUM is associated with ACL injury susceptibility and that genetic sequence variability within genes encoding proteoglycans may potentially modulate the ligament fibril properties.
24516061 meta-analysis, including 1,545 subjects from 5 studies, indicated that Chinese lumican rs3759223 C allele carriers had a decreased risk of high myopia in comparison to T allele carriers
24367547 Lumican binds ALK5 to promote epithelium wound healing
24061151 This meta-analysis showed the evidence that SNP rs3759223 may affect individual susceptibility to high myopia in the Chinese population.
23846574 lumican may be involved in cell growth and invasion through the regulation of 24 proteins expressed in pancreatic ductal adenocarcinoma.
More...

AA Sequence

MSLSAFTLFLALIGGTSGQYYDYDFPLSIYGQSSPNCAPECNCPESYPSAMYCDELKLKSVPMVPPGIKY      1 - 70
LYLRNNQIDHIDEKAFENVTDLQWLILDHNLLENSKIKGRVFSKLKQLKKLHINHNNLTESVGPLPKSLE     71 - 140
DLQLTHNKITKLGSFEGLVNLTFIHLQHNRLKEDAVSAAFKGLKSLEYLDLSFNQIARLPSGLPVSLLTL    141 - 210
YLDNNKISNIPDEYFKRFNALQYLRLSHNELADSGIPGNSFNVSSLVELDLSYNKLKNIPTVNENLENYY    211 - 280
LEVNQLEKFDIKSFCKILGPLSYSKIKHLRLDGNRISETSLPPDMYECLRVANEVTLN                281 - 338
//

Text Mined References (88)

PMID Year Title
26351669 2015 TNF-?-stimulated fibroblasts secrete lumican to promote fibrocyte differentiation.
25304424 2014 Lumican: a new inhibitor of matrix metalloproteinase-14 activity.
25304290 2014 Gene expression profiling of giant cell tumor of bone reveals downregulation of extracellular matrix components decorin and lumican associated with lung metastasis.
24956166 2014 Meta-analysis of the association between lumican gene polymorphisms and susceptibility to high Myopia.
24927138 2014 Lack of association between LUM rs3759223 polymorphism and high myopia.
24804215 2014 Extracellular matrix proteins expression profiling in chemoresistant variants of the A2780 ovarian cancer cell line.
24552666 2014 Genes encoding proteoglycans are associated with the risk of anterior cruciate ligament ruptures.
24516061 2014 Association between a lumican promoter polymorphism and high myopia in the Chinese population: a meta-analysis of case-control studies.
24376456 2013 Gene-alcohol interactions identify several novel blood pressure loci including a promising locus near SLC16A9.
24367547 2013 Lumican binds ALK5 to promote epithelium wound healing.
More...