Property Summary

NCBI Gene PubMed Count 24
PubMed Score 1.58
PubTator Score 3.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7933 2.4e-06
dermatomyositis 966 2.0e-04
Waldenstrons macroglobulinemia 764 4.4e-03
ovarian cancer 8491 1.1e-02

Expression

  Differential Expression (4)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.022 4.4e-03
osteosarcoma -2.433 2.4e-06
ovarian cancer 1.300 1.1e-02
dermatomyositis 1.400 2.0e-04

Pathway (1)

Gene RIF (2)

PMID Text
24429498 Loss of LUC7L2 is associated with myeloid neoplasms.
23125841 Tandem affinity purification and mass spectrometry analysis identify putative RNA-binding protein Luc7-like 2 (LUC7L2), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells

AA Sequence

MSAQAQMRAMLDQLMGTSRDGDTTRQRIKFSDDRVCKSHLLNCCPHDVLSGTRMDLGECLKVHDLALRAD      1 - 70
YEIASKEQDFFFELDAMDHLQSFIADCDRRTEVAKKRLAETQEEISAEVAAKAERVHELNEEIGKLLAKV     71 - 140
EQLGAEGNVEESQKVMDEVEKARAKKREAEEVYRNSMPASSFQQQKLRVCEVCSAYLGLHDNDRRLADHF    141 - 210
GGKLHLGFIEIREKLEELKRVVAEKQEKRNQERLKRREEREREEREKLRRSRSHSKNPKRSRSREHRRHR    211 - 280
SRSMSRERKRRTRSKSREKRHRHRSRSSSRSRSRSHQRSRHSSRDRSRERSKRRSSKERFRDQDLASCDR    281 - 350
DRSSRDRSPRDRDRKDKKRSYESANGRSEDRRSSEEREAGEI                                351 - 392
//

Text Mined References (30)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24429498 2014 Recurrent genetic defects on chromosome 7q in myeloid neoplasms.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23602568 2013 The protein interaction landscape of the human CMGC kinase group.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
21900206 2011 A directed protein interaction network for investigating intracellular signal transduction.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20562859 2010 Network organization of the human autophagy system.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19584937 2009 Identification of novel reference genes using multiplatform expression data and their validation for quantitative gene expression analysis.
19574390 2009 Jmjd6 catalyses lysyl-hydroxylation of U2AF65, a protein associated with RNA splicing.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17726058 2007 The U1 snRNP-associated factor Luc7p affects 5' splice site selection in yeast and human.
17656373 2007 Evidence for a direct role of the disease modifier SCNM1 in splicing.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15383276 2004 A protein interaction network links GIT1, an enhancer of huntingtin aggregation, to Huntington's disease.
15324660 2004 Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
15231748 2004 Functional proteomics mapping of a human signaling pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10810093 2000 Identification of novel human genes evolutionarily conserved in Caenorhabditis elegans by comparative proteomics.