Property Summary

NCBI Gene PubMed Count 17
PubMed Score 9.70
PubTator Score 43.82

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
ependymoma 1.300 1.9e-02
intraductal papillary-mucinous adenoma (... 1.100 1.7e-02
juvenile dermatomyositis 1.234 7.1e-13
oligodendroglioma 1.500 6.6e-03
osteosarcoma -3.649 9.7e-08
ovarian cancer -1.100 5.6e-08
pancreatic ductal adenocarcinoma liver m... 1.513 1.7e-02
psoriasis -1.200 1.1e-03

 MGI Phenotype (1)

Gene RIF (2)

AA Sequence

MSAQAQMRALLDQLMGTARDGDETRQRVKFTDDRVCKSHLLDCCPHDILAGTRMDLGECTKIHDLALRAD      1 - 70
YEIASKERDLFFELDAMDHLESFIAECDRRTELAKKRLAETQEEISAEVSAKAEKVHELNEEIGKLLAKA     71 - 140
EQLGAEGNVDESQKILMEVEKVRAKKKEAEEEYRNSMPASSFQQQKLRVCEVCSAYLGLHDNDRRLADHF    141 - 210
GGKLHLGFIQIREKLDQLRKTVAEKQEKRNQDRLRRREEREREERLSRRSGSRTRDRRRSRSRDRRRRRS    211 - 280
RSTSRERRKLSRSRSRDRHRRHRSRSRSHSRGHRRASRDRSAKYKFSRERASREESWESGRSERGPPDWR    281 - 350
LESSNGKMASRRSEEKEAGEI                                                     351 - 371
//

Text Mined References (24)

PMID Year Title