Property Summary

NCBI Gene PubMed Count 22
PubMed Score 12.27
PubTator Score 35.27

Knowledge Summary

Patent (4,901)

Expression

  Differential Expression (6)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.100 1.9e-04
medulloblastoma -1.100 2.9e-05
medulloblastoma, large-cell -1.100 1.1e-03
intraductal papillary-mucinous adenoma (... 1.100 4.6e-03
ulcerative colitis -1.300 5.9e-05
ovarian cancer -1.100 7.9e-06

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (4)

PMID Text
26630010 Data show FAM150B, which was named as augmentor-alpha (AUG-alpha), binds and activtes both anaplastic lymphoma kinase (ALK) and tyrosine kinase (LTK).
25331893 Only two related secreted factors, FAM150A and FAM150B (family with sequence similarity 150 member A and member B), stimulated LTK phosphorylation.
22347506 aberrant activation of LTK may contribute to neoplastic cell growth.
14695357 polymorphic LTKs cause up-regulation of the PI3K pathway and possibly form one genetic component of susceptibility to abnormal proliferation of self-reactive B cells in systemic lupus erythematosus

AA Sequence

MGCWGQLLVWFGAAGAILCSSPGSQETFLRSSPLPLASPSPRDPKVSAPPSILEPASPLNSPGTEGSWLF      1 - 70
STCGASGRHGPTQTQCDGAYAGTSVVVTVGAAGQLRGVQLWRVPGPGQYLISAYGAAGGKGAKNHLSRAH     71 - 140
GVFVSAIFSLGLGESLYILVGQQGEDACPGGSPESQLVCLGESRAVEEHAAMDGSEGVPGSRRWAGGGGG    141 - 210
GGGATYVFRVRAGELEPLLVAAGGGGRAYLRPRDRGRTQASPEKLENRSEAPGSGGRGGAAGGGGGWTSR    211 - 280
APSPQAGRSLQEGAEGGQGCSEAWATLGWAAAGGFGGGGGACTAGGGGGGYRGGDASETDNLWADGEDGV    281 - 350
SFIHPSSELFLQPLAVTENHGEVEIRRHLNCSHCPLRDCQWQAELQLAECLCPEGMELAVDNVTCMDLHK    351 - 420
PPGPLVLMVAVVATSTLSLLMVCGVLILVKQKKWQGLQEMRLPSPELELSKLRTSAIRTAPNPYYCQVGL    421 - 490
GPAQSWPLPPGVTEVSPANVTLLRALGHGAFGEVYEGLVIGLPGDSSPLQVAIKTLPELCSPQDELDFLM    491 - 560
EALIISKFRHQNIVRCVGLSLRATPRLILLELMSGGDMKSFLRHSRPHLGQPSPLVMRDLLQLAQDIAQG    561 - 630
CHYLEENHFIHRDIAARNCLLSCAGPSRVAKIGDFGMARDIYRASYYRRGDRALLPVKWMPPEAFLEGIF    631 - 700
TSKTDSWSFGVLLWEIFSLGYMPYPGRTNQEVLDFVVGGGRMDPPRGCPGPVYRIMTQCWQHEPELRPSF    701 - 770
ASILERLQYCTQDPDVLNSLLPMELGPTPEEEGTSGLGNRSLECLRPPQPQELSPEKLKSWGGSPLGPWL    771 - 840
SSGLKPLKSRGLQPQNLWNPTYRS                                                  841 - 864
//

Text Mined References (28)

PMID Year Title
26630010 2015 Augmentor ? and ? (FAM150) are ligands of the receptor tyrosine kinases ALK and LTK: Hierarchy and specificity of ligand-receptor interactions.
26418745 2015 FAM150A and FAM150B are activating ligands for anaplastic lymphoma kinase.
25331893 2014 Deorphanization of the human leukocyte tyrosine kinase (LTK) receptor by a signaling screen of the extracellular proteome.
22347506 2012 ALK-activating homologous mutations in LTK induce cellular transformation.
20548102 2010 MAPK signaling to the early secretory pathway revealed by kinase/phosphatase functional screening.
19815557 2009 Cytoplasmic ACK1 interaction with multiple receptor tyrosine kinases is mediated by Grb2: an analysis of ACK1 effects on Axl signaling.
18849880 2008 Expression of a chimeric CSF1R-LTK mediates ligand-dependent neurite outgrowth.
17910947 2007 Identification of twinfilin-2 as a factor involved in neurite outgrowth by RNAi-based screen.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14695357 2004 Gain-of-function polymorphism in mouse and human Ltk: implications for the pathogenesis of systemic lupus erythematosus.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12237455 2002 The SPOT technique as a tool for studying protein tyrosine phosphatase substrate specificities.
12107410 2002 Expressed sequence tag analysis of human RPE/choroid for the NEIBank Project: over 6000 non-redundant transcripts, novel genes and splice variants.
10445845 1999 Heart-specific activation of LTK results in cardiac hypertrophy, cardiomyocyte degeneration and gene reprogramming in transgenic mice.
9223670 1997 The phosphatidylinositol 3' kinase pathway is required for the survival signal of leukocyte tyrosine kinase.
8995435 1997 A lymphocyte-specific Ltk tyrosine kinase isoform is retained in the endoplasmic reticulum in association with calnexin.
8910363 1996 Growth and survival signals transmitted via two distinct NPXY motifs within leukocyte tyrosine kinase, an insulin receptor-related tyrosine kinase.
8427607 1993 Identification of the human ltk gene product in placenta and hematopoietic cell lines.
8084603 1994 Human ltk receptor tyrosine kinase binds to PLC-gamma 1, PI3-K, GAP and Raf-1 in vivo.
7851890 1994 Regional localization of human chromosome 15 loci.
7685902 1993 Differently spliced cDNAs of human leukocyte tyrosine kinase receptor tyrosine kinase predict receptor proteins with and without a tyrosine kinase domain and a soluble receptor protein.
2836739 1988 Leukocytes express a novel gene encoding a putative transmembrane protein-kinase devoid of an extracellular domain.
2320375 1990 Human ltk: gene structure and preferential expression in human leukemic cells.
2156206 1990 Identification and chromosomal mapping of new human tyrosine kinase genes.
1655406 1991 The ltk gene encodes a novel receptor-type protein tyrosine kinase.