Property Summary

Ligand Count 10
NCBI Gene PubMed Count 22
PubMed Score 12.65
PubTator Score 35.27

Knowledge Summary

Patent (4,901)

TINX Plot

  Disease (5)

Expression

  Differential Expression (6)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.100 1.9e-04
intraductal papillary-mucinous adenoma (... 1.100 4.6e-03
medulloblastoma -1.100 2.9e-05
medulloblastoma, large-cell -1.100 1.1e-03
ovarian cancer -1.100 7.9e-06
ulcerative colitis -1.300 5.9e-05

Gene RIF (4)

AA Sequence

MGCWGQLLVWFGAAGAILCSSPGSQETFLRSSPLPLASPSPRDPKVSAPPSILEPASPLNSPGTEGSWLF      1 - 70
STCGASGRHGPTQTQCDGAYAGTSVVVTVGAAGQLRGVQLWRVPGPGQYLISAYGAAGGKGAKNHLSRAH     71 - 140
GVFVSAIFSLGLGESLYILVGQQGEDACPGGSPESQLVCLGESRAVEEHAAMDGSEGVPGSRRWAGGGGG    141 - 210
GGGATYVFRVRAGELEPLLVAAGGGGRAYLRPRDRGRTQASPEKLENRSEAPGSGGRGGAAGGGGGWTSR    211 - 280
APSPQAGRSLQEGAEGGQGCSEAWATLGWAAAGGFGGGGGACTAGGGGGGYRGGDASETDNLWADGEDGV    281 - 350
SFIHPSSELFLQPLAVTENHGEVEIRRHLNCSHCPLRDCQWQAELQLAECLCPEGMELAVDNVTCMDLHK    351 - 420
PPGPLVLMVAVVATSTLSLLMVCGVLILVKQKKWQGLQEMRLPSPELELSKLRTSAIRTAPNPYYCQVGL    421 - 490
GPAQSWPLPPGVTEVSPANVTLLRALGHGAFGEVYEGLVIGLPGDSSPLQVAIKTLPELCSPQDELDFLM    491 - 560
EALIISKFRHQNIVRCVGLSLRATPRLILLELMSGGDMKSFLRHSRPHLGQPSPLVMRDLLQLAQDIAQG    561 - 630
CHYLEENHFIHRDIAARNCLLSCAGPSRVAKIGDFGMARDIYRASYYRRGDRALLPVKWMPPEAFLEGIF    631 - 700
TSKTDSWSFGVLLWEIFSLGYMPYPGRTNQEVLDFVVGGGRMDPPRGCPGPVYRIMTQCWQHEPELRPSF    701 - 770
ASILERLQYCTQDPDVLNSLLPMELGPTPEEEGTSGLGNRSLECLRPPQPQELSPEKLKSWGGSPLGPWL    771 - 840
SSGLKPLKSRGLQPQNLWNPTYRS                                                  841 - 864
//

Text Mined References (28)

PMID Year Title