Property Summary

NCBI Gene PubMed Count 271
PubMed Score 349.04
PubTator Score 348.69

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Celiac disease 116 0.0 2.6
Disease Target Count Z-score Confidence
Dental caries 164 3.648 1.8
Nasopharyngitis 11 3.395 1.7
Chickenpox 8 3.06 1.5

Expression

  Differential Expression (29)

Disease log2 FC p
ulcerative colitis 2.500 1.0e-02
adult high grade glioma 2.300 2.9e-02
astrocytoma 1.200 6.1e-03
Atopic dermatitis 3.400 9.6e-05
Breast cancer -2.900 3.8e-04
chronic kidney disease 3.000 1.8e-02
chronic rhinosinusitis 2.935 3.9e-02
cystic fibrosis 1.900 1.8e-02
ependymoma 1.800 3.7e-02
gastric cancer 1.100 2.8e-03
glioblastoma 1.700 4.8e-02
hepatocellular carcinoma 1.600 2.0e-02
interstitial cystitis 4.600 2.9e-04
intraductal papillary-mucinous adenoma (... -1.400 3.6e-04
intraductal papillary-mucinous neoplasm ... -1.500 4.1e-03
mucosa-associated lymphoid tissue lympho... 3.985 1.4e-02
nasopharyngeal carcinoma -4.200 7.9e-06
non-small cell lung cancer 1.148 2.1e-02
osteosarcoma -7.990 6.3e-10
pancreatic cancer 1.700 1.9e-02
pancreatic carcinoma 1.700 1.9e-02
pituitary cancer -1.500 4.3e-02
primary pancreatic ductal adenocarcinoma 1.882 2.0e-03
psoriasis 3.700 1.1e-07
severe Alzheimer's disease 1.510 2.7e-02
severe asthma -1.300 1.7e-05
subependymal giant cell astrocytoma 5.248 3.7e-03
tuberculosis 2.100 1.1e-02
Waldenstrons macroglobulinemia 2.913 6.3e-03

PDB (32)

Gene RIF (196)

AA Sequence

MKLVFLVLLFLGALGLCLAGRRRSVQWCAVSQPEATKCFQWQRNMRKVRGPPVSCIKRDSPIQCIQAIAE      1 - 70
NRADAVTLDGGFIYEAGLAPYKLRPVAAEVYGTERQPRTHYYAVAVVKKGGSFQLNELQGLKSCHTGLRR     71 - 140
TAGWNVPIGTLRPFLNWTGPPEPIEAAVARFFSASCVPGADKGQFPNLCRLCAGTGENKCAFSSQEPYFS    141 - 210
YSGAFKCLRDGAGDVAFIRESTVFEDLSDEAERDEYELLCPDNTRKPVDKFKDCHLARVPSHAVVARSVN    211 - 280
GKEDAIWNLLRQAQEKFGKDKSPKFQLFGSPSGQKDLLFKDSAIGFSRVPPRIDSGLYLGSGYFTAIQNL    281 - 350
RKSEEEVAARRARVVWCAVGEQELRKCNQWSGLSEGSVTCSSASTTEDCIALVLKGEADAMSLDGGYVYT    351 - 420
AGKCGLVPVLAENYKSQQSSDPDPNCVDRPVEGYLAVAVVRRSDTSLTWNSVKGKKSCHTAVDRTAGWNI    421 - 490
PMGLLFNQTGSCKFDEYFSQSCAPGSDPRSNLCALCIGDEQGENKCVPNSNERYYGYTGAFRCLAENAGD    491 - 560
VAFVKDVTVLQNTDGNNNEAWAKDLKLADFALLCLDGKRKPVTEARSCHLAMAPNHAVVSRMDKVERLKQ    561 - 630
VLLHQQAKFGRNGSDCPDKFCLFQSETKNLLFNDNTECLARLHGKTTYEKYLGPQYVAGITNLKKCSTSP    631 - 700
LLEACEFLRK                                                                701 - 710
//

Text Mined References (277)

PMID Year Title