Property Summary

NCBI Gene PubMed Count 249
PubMed Score 332.54
PubTator Score 348.69

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Celiac disease 112 0.0 2.0
Disease Target Count Z-score Confidence
Dental caries 67 3.511 1.8
Nasopharyngitis 11 3.498 1.7
Chickenpox 6 3.086 1.5

Expression

  Differential Expression (29)

 CSPA Cell Line (1)

Gene RIF (177)

PMID Text
26649297 M-860 induces the activation of huPMNs partially through TLR4 ... M-860 is thus a powerful tool to analyze the expression and function of human mbLTF, which will further our understanding of the roles of LTF in health and disease.
26469086 This study showed that recombinant lactoferrin had antibacterial activity on Salmonella infection.
26445132 Lactoferrin modulates parameters of sperm function. The inhibition of gamete interaction by LF could be partially explained by the decrease in sperm d-mannose-binding sites. The presence of the LF promoted sperm capacitation in vitro.
26405758 LTF C-lobe contributes to its anti-tumor activity.
26366224 the possible relationship between ocular symptomatology, tear volume and tear break-up time (TBUT) and lipocalin, lactoferrin and lysozyme concentrations in the tear film were explored in a group of symptomatic dry-eyed postmenopausal (PM) women.
26279447 LF triggered CREB1 phosphorylation in IL-1beta-induced Human articular chondrocytes apoptosis through AKT1 signaling.
25946246 results suggest that LTF genetic polymorphisms Thr29Ala and Arg47Lys are not associated with susceptibility to HIV-1 MTCT, but our data are preliminary, obtained on low number of individual, also lacking of functional characterisation of the analysed SNPs
25916224 Fecal lactoferrin levels were significantly higher in patients with pouchitis than those without pouchitis after restorative proctocolectomy for ulcerative colitis.
25914748 Tear lysozyme, lactoferrin and lipocalin concentrations were determined via electrophoresis and the results for patients with or without eyelid tumors were compared.
25784250 review summarizes data supporting the ecologic plaque hypothesis and suggests that a genetic variant in lactoferrin with K in position 29 when found in saliva and crevice fluid can influence community biofilm composition.
25445609 A peptide derived from human lactoferricin inhibits HIV-1 RT activity in a dose-dependent manner
25405719 diagnostic contribution of calprotectin and lactoferrin determinations in the cerebrospinal fluid when distinguishing between bacterial and aseptic meningitides
25286756 Lactotransferrin could independently predict prognosis (DFS: HR = 0.414, P = 0.003; OS: HR = 0.309, P = 0.005). These observations indicated that Lactotransferrin is a potential prognostic factor of nasopharyngeal carcinoma
25236863 Both the hLF and hLZ were expressed in the mammary gland of bi-transgenic pigs, as detected by western blotting.Interestingly, pig milk containing hLF and hLZ had synergistic antimicrobial activity
25193851 Lactoferrin protein inhibited Hepatitis C virus replication by interaction with viral NS3.
25057912 Results show that LTF gene expression is downregulated in colorectal cancer tumors and its knock out in mouse model of colitis-associated colorectal dysplasia suggests its protective role in colorectal mucosal immunity and inflammation.
24970346 Since early host-microbe interaction is a crucial component of healthy immune and metabolic programming, high levels of fecal LF may beneficially contribute to the immunologic maturation and well-being of the newborn, especially in pre-term infants.
24831229 assessed the diagnostic ability of intestinal permeability test and fecal lactoferrin in distinguishing functional from organic disease in patients with chronic diarrhea
24571258 Endogenous LTF biosynthesis during human adipocyte differentiation is essential to achieve this process.
24442915 FRET fingerprints of fluorescent lactoferrins are used to monitor the interaction of lactoferrin with a healthy bacterium, Bifidobacterium breve.
24340941 The dynamics of changes in lysozyme activity and content of lactoferrin content of patients with chronic osteomyelitis
24217007 The LTF 140A/G (exon 2, Lys/Arg) polymorphism was not associated with the susceptibility to or severity of dental caries in the Czech population.
24077968 the accumulation of lactoferrin in PD brains might be evidence of an attempt by the brain to minimize the consequences of neurodegeneration.
23479198 Lactotransferrin was up-regulated in nasopharyngeal carcinoma.
23460521 Our results provide functional evidence that the LTF/K variant results in both anti-S. mutans activity and reduced decay. We suggest that the LTF/K variant can influence oral microbial ecology in general and caries-provoking microbes specifically.
23427237 human lactoferrin interacts with spermatozoa and oocytes and modulates gamete interaction
23333090 administration of lactoferrin led to autopotentiated increased expression of the LTF gene. The decreased lactoferrin mRNA levels in association with obesity and diabetes were replicated in mice adipose tissue
23069661 Lactotransferrin acts as a tumor suppressor in nasopharyngeal carcinoma by repressing AKT through multiple mechanisms.
22900286 structure of seminal diferric lactoferrin
22806010 Instead, apo-lactoferrin increased adherence to and internalisation of bacteria into cultured epithelial cells.
22763972 Chronic alcohol intoxication decreases salivary flow and lactoferrin output.
22731992 LF release at sites of inflammation may alter eosinophil recruitment/activation and possibly the progression of diseases such as cancer and asthma where significant eosinophil influx has been described.
22553915 The roles of lactoferrin in mucosal immunity and neutrophil function. [Review]
22523385 An antimicrobial peptide GRRRRSVQWCA (LF1-11), derived from human lactoferrin N-terminus, may exert its modulatory effects on human monocytes by specific inhibition of myeloperoxidase activity.
22433582 These data suggest that LF may inhibit Epstein-Barr virus infection and that its downregulation could contribute to nasopharyngeal carcinoma development.
22406253 The G allele of the LTF rs1126478 was more frequent in patients with significant coronary artery stenosis.
22380846 Lactoferrin is internalized mainly by the clathrin-dependent pathway in THP-1 cells and targets the endoplasmic reticulum.
22320386 differential post-translational modifications may contribute to the establishment of fine regulation of delta-lactoferrin transcriptional activity depending on the type of target gene and cellular homeostasis. [Review]
22261723 lactoferrin glycosylation is tightly regulated by gene expression and that glyco-variation is involved in modulating pathogen association.
22226679 Lf bound to a DNA region in the ICAM-1 promoter
22173721 LF and OSF-2 gene polymorphisms may have deep impact on the risk of rhinosinusitis nasal polyps' formation.
22011934 These findings suggested that LTF gene polymorphisms could play important roles in nasopharyngeal carcinoma physiological processes.
22006997 Lactoferrin directly stimulates the transcription of endothelin-1.
21937479 The relationship of haplotype in lactotransferrin and its expression levels in Chinese Han ovarian cancer
21935933 Lactoferrin receptor is a major pathway through which lactoferrin is taken up by enterocytes, which occurs independently of iron saturation through clathrin-mediated endocytosis.
21847071 A peptide derived from human lactoferricin inhibits HIV-1 RT activity in a dose-dependent manner
21572958 IL-1ss and lactoferrin are biomarkers for sexually transmitted diseases/colonizations providing insights into immune responses and pathogenesis at genital tract mucosal site.
21525168 The proteomes of the type-1 diabetic, type-2 diabetic, and non-diabetic obese patients presented elevated amounts of the same set of one molecular form of semenogelin-1, one form of clusterin, and two forms of lactotransferrin.
21400573 lactoferrin may participate in nasopharyngeal carcinoma carcinogenesis as a negative effector, that is, a tumor suppressor gene
21163060 There is an inactivation of expression of the LTF gene in the nasopharyngeal carcinoma cell lines.
21055448 Study provides essential knowledge regarding the different roles of bioactive sites of lactoferrins in lectin-N-glycan recognition processes.
20972893 Our findings indicate a role for LF as a bone growth regulator in the early phases of the human endochondral ossification, although the hypothesis of LF as oncofetal marker appears questionable in bone tumours.
20963400 No association between serum lactoferrin and bone ineral density at the lumbar spine or femoral neck was detected in elderly women
20922188 Fecal lactoferrin has a high positive and negative predictive value for the diagnosis of small bowel Crohn's disease, detected by capsule endoscopy.
20673868 Observational study of gene-disease association. (HuGE Navigator)
20668874 Significant decreases in secretion rates and absolute concentrations of saliva immunoglobulin A and lactoferrin were seen at times of intense training and competition.
20598696 Lactoferrin may have a role in fatal ischemic heart disease in diabetes mellitus type 2
20594128 Studies indicate that both calprotectin and lactoferrin are markers of inflammatory bowel disease.
20587610 Observational study of gene-disease association. (HuGE Navigator)
20503287 Observational study of gene-disease association. (HuGE Navigator)
20485928 Lactotransferrin A/G (exon 2, Lys/Arg) polymorphism was associated with susceptibility to dental caries in 12-year-old students
20485928 Observational study of gene-disease association. (HuGE Navigator)
20452482 Observational study of gene-disease association. (HuGE Navigator)
20411301 Lactoferrin exploits the control mechanism of E2F1-regulated target genes or Bcl-2 family gene networks involved in the apoptotic process in Jurkat human leukemia T lymphocytes.
20404350 O-GlcNAcylation/phosphorylation cycling at Ser10 controls both transcriptional activity and stability of delta-lactoferrin
20401683 Data show that that the positive selection sites were either located in the LF-bacteria binding region or the peptides of LFcin and LFampin, indicating that the selection pressure was related to LF-bacteria interaction.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20345905 Human lactoferrin fails to activate NF-kappaB in mouse embryonic fibroblasts lacking Toll-like receptor 4 (TLR4)
20238236 monocytes were primed by hLF1-11 for an enhanced inflammatory response upon TLR4, TLR5, and TLR7 stimulation, but not TLR2 stimulation
20237496 Observational study of gene-disease association. (HuGE Navigator)
20207115 These results suggest that negatively charged lactoferrin aggregates adsorb only onto positively charged surfaces.
20155438 REVIEW: LF seems to be a biofilm inhibitor of periodontopathic bacteria in vitro and in vivo
20136960 Fecal lactoferrin can be used to effectively disease activity in patients with idiopathic ulcerative colitis.
19997820 Lactoferrin is expressed in neoplastic cells of Chondroblastoma and chondromyxoid fibromas and in fetal cartilage tissue: this may reflect a less mature phenotype of these tumors.
19916937 The diameter of a complex formed when LF is added to the 2CP-1MPO complex is 10.7 nm.
19834535 Observational study of gene-disease association. (HuGE Navigator)
19651866 These results extend previous studies of the importance of lactoferrin in the innate immune defense against bacterial biofilms.
19563039 The concentration of lactoferrin in children with dental caries was higher than that in controls.
19454813 Lactoferrin may play an important role as a precipitate protein in pancreatic stone formation in chronic pancreatitis and as an autoantigen in autoimmune pancreatitis
19435495 Results show that the cationic nature is not a major determinant in the anti-HSV action of mucosal innate cationic polypeptides, since whereas human Lactoferrin inhibited HSV-1 infection efficiently, human lysozyme had no HSV-1 inhibiting activity.
19382280 Lactoferrin (LF) in solution at neutral pH is oligomerized in the absence of salt or at physiological salt concentrations.
19348738 study has shown that expression of LF mRNA is up-regulated in the cortex of Alzheimer's disease patients; also demonstrated LF mRNA is expressed by activated microglial cells or leukocytes that have infiltrated the cortex of Alzheimer's disease brain
19334538 DNA and oligosaccharides stimulate oligomerization of human milk lactoferrin
19282435 These results suggest that lactoferrin present at high levels at mucosal sites can facilitate Adenovirus serotype 5 attachment and enhance infection of DCs.
19258923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19240970 Lactoferrin (Lf) expression was investigated by using a Lf monoclonal antibody in 50 formalin-fixed and paraffin-embedded human bone tumours and normal bone specimens.
19033648 Results identify lactoferrin as an antiinflammatory component of the apoptosis milieu and suggest that lactoferrin may function as a negative regulator of granulocyte migration.
18977241 Observational study of gene-disease association. (HuGE Navigator)
18973542 the A/G polymorphism might be associated with aggressive periodontitis [in Taiwan]
18973542 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18785755 results demonstrated that chimeric proteins containing the N-lobe or the N1.1 subdomain of Lf bound as well as intact Lf to Caco-2 cells
18697201 Lactotransferrin is likely to be a candidate tumor suppressor and downregulates the development of nasopharyngeal carcinoma (NPC) by inhibiting NPC proliferation through induction of cell cycle arrest and modulation of the MAPK signaling pathway.
18619616 promotes wound repair in vivo, correlating with a modulated enhancement of the early inflammatory phase of wound healing
18573312 Lactoferrin is an iron binding protein that also has antimicrobial, antiviral, antifungal and antiparasitic activity.
18453607 lactoferrin contributes to the activation of both the innate and adaptive immune responses by promoting the recruitment of leukocytes and activation of dendritic cells.
18285402 This secondary granule protein is present in cells from the myelocyte stage and throughout neutrophil differentiation.
18183929 A peptide derived from human lactoferricin inhibits HIV-1 RT activity in a dose-dependent manner
18156281 We have identified associations among LTF polymorphisms, circulating lactoferrin concentration, fasting triglyceride concentration, and vascular reactivity in humans.
18156281 Observational study of gene-disease association. (HuGE Navigator)
18022620 genotypes. Lactoferrin Glu561Asp polymorphism is associated with the susceptibility to HSV keratitis with a protective role for lactoferrin variants comprising Asp561
18022620 Observational study of gene-disease association. (HuGE Navigator)
17947640 both IKKalpha and IKKbeta as well as NF-kappaB-inducing kinase are indispensable for lactoferrin-induced p65 phosphorylation
17703412 Observational study of gene-disease association. (HuGE Navigator)
17601350 Observational study of gene-disease association. (HuGE Navigator)
17597152 describe a study of the conformation of the human lactoferrin/ceruloplasmin complex in solution using small angle X-ray scattering
17568188 potential for LTF in chemoprevention and to become a biologically relevant prognostic marker of prostate cancer (CaP), suggesting that silencing of the LTF gene may be causally linked to CaP progression.
17543335 specific electrostatic interactions observed in the crystal structure represent major associations between PspA and lactoferrin
17515863 Directly induces enterocyte growth and proliferation, depending on its concentration, thereby regulating the early postnatal intestinal development in breast-fed infants.
17503830 Denaturation of recombinant lactoferrin in milk was compared with denaturation in phosphate buffer, and results indicated that the protein was more heat-sensitive when treated in milk than in buffer.
17476971 data indicate that two-hit silencing of LTF through genetic and epigenetic changes may be a common and important event in the carcinogenesis of nasopharyngeal carcinoma
17475866 Lactoferrin sequestration of iron by human neutrophils is important for host defense against the common mold Aspergillus fumigatus.
17461450 Fecal lactoferrin and hemoglobin were found useful in the detection of colorectal diseases, and the combination of the two measurements appears to increase the sensitivity and efficacy of diagnosis.
17390038 The reduced Lf immunoexpression in some CCC may be because of the down-regulation of Lf gene due to the frequent deletion of 3p regions reported in this RCC variant.
17342646 Observational study of gene-disease association. (HuGE Navigator)
17211147 Lactoferrin in human milk may act as an antioxidant in the gastrointestinal tract.
17208010 High-level expression of LTF in the milk of goats was accomplished by using replication-defective adenoviral vectors.
17079302 identified human lactoferrin (HLf) as the tear fluid component responsible for binding of adenovirus to epithelial cells in a dose-dependent manner and also infection of epithelial cells by adenovirus.
17030385 These results suggest that Lf in the parotid saliva of periodontitis patients was degraded into small peptides by the PR3-like activity with the capability to induce inflammatory mediators.
17015741 LTF limited specifically adsorption of R5- and X4-HIV-1-free particles on endometrial epithelial cells, did not interfere with both R5 and X4-HIV transcytosis, prevented R5 and X4-HIV capture by dendritic cells
16954396 High lactoferrin concentrations in the milk of transgenic cows do not protect them from intramammary Escherichia coli infection.
16936811 Ninety-one healthy donors of different ethnicities were used to establish common single nucleotide polymorphisms (SNPs) in the exons of the lactoferrin gene in the general population.
16936805 The antiproliferative effects of Lf can likely be attributed to the elevated levels of hypophosphorylated Rb.
16936800 Lactoferrin might have a physiological role in bone growth and healing and a potential therapeutic role as an anabolic factor in osteoporosis.
16928883 A peptide derived from human lactoferricin inhibits HIV-1 RT activity in a dose-dependent manner
16842782 Lactoferrin upregulates KDR/Flk-1 mRNA and protein levels in vascular endothelial cells, which subsequently promotes the VEGF-induced proliferation and migration of the endothelial cells.
16820307 lactoferrin is induced from human neutrophils by tryptic enzymes via proteinase activated receptor-2
16787913 LF bound to the RGD-containing human extracellular matrix proteins, fibronectin and vitronectin; a function of human LF is to block the various interactions between the cell surface and adhesion molecules
16769765 The surface-expressed LF released from PMN after contact with autologous CD4+ T modulated its T helper cell type 1 (Th1)/Th2 cytokine production. Decreased LF expression on SLE-PMN abnormally modulates Th1/Th2 production by CD4+ T cells.
16650524 results demonstrate that lactoferrin promotes osteoblast survival, an effect that may contribute to its anabolic skeletal actions in vivo
16644090 Women with minimal endometriosis had lower PF lactoferrin concentrations compared to both patients with high revised American Fertility Society classification scores and women with follicle ovarian cysts.
16432833 Transcription of the LTF and transcription of the SLC38A3 gene, were impaired in all 5 RCC cell lines analyzed. Our data indicate these genes as putative tumour suppressor genes.
16261256 Overview of multifunctional roles of lactoferrin (LTF) provides an update on our current understanding of the cellular and molecular mechanisms of action responsible for the biological activities of LTF.
16261253 Lactoferrin can be considered not only a primary defense factor against mucosal infections, but also a polyvalent regulator which interacts with several microbial, viral and host components involved in infectious processes.
16261253 A peptide derived from human lactoferricin inhibits HIV-1 RT activity in a dose-dependent manner
16208406 In a pilot case-controlled study of aggressive periodontitis, analysis of 46 African-American patients and 78 controls showed that patients were twice as likely to express the G nucleotide (alanine) allele over controls.
16152584 Lactotransferrin gene is inactivated by genetic and epigenetic mechanisms in lung cancer
15955101 This work identifies lactoferrin in saliva as ligand for HHV-8 and suggests that this glycoprotein could be used as carrier for viral particles.
15793153 induced delayed tobramycin-killing effect on Pseudomonas aeruginosa cells correlated to induced cell depolarization
15709021 A peptide derived from human lactoferricin inhibits HIV-1 RT activity in a dose-dependent manner
15543612 Prognostic marker, high concentrations being associated with a longer overall breast cancer survival.
15525592 the context of the lactoferrin gene influences the ERalpha-mediated transcriptional activity.
15378004 describes that lactoferrin specifically transactivates the p53 tumor suppressor gene through the activation of nuclear factor-kappaB and consequently regulates p53-responsive oncogenes
15364102 exerts its candidacidal effect through a mechanism different from membrane permeabilization described for other cationic peptides.
15297857 Plasma levels do not affect the number of infections or ocmplications in sickle-cell anemia.
15222485 Results suggest that delta-lactoferrin may play an important role in the regulation of normal cell growth.
15222484 Results describe the methylation profile in three regions of the human lactoferrin gene by bisulfite genomic sequencing.
15222480 A peptide derived from human lactoferricin inhibits HIV-1 RT activity in a dose-dependent manner
15221967 Recombinant compound shows promise as a safe and well-tolerated novel immunomodulatory anticancer agent.
15166119 lactoferrin has powerful anabolic, differentiating, and antiapoptotic effects on osteoblasts and inhibits osteoclastogenesis.
14717698 A peptide derived from human lactoferricin inhibits HIV-1 RT activity in a dose-dependent manner
12826902 high prevalence of autoantibodies against human carbonic anhydrase II and lactoferrin strongly suggests the involvement of autoimmunity against the exocrine pancreas as well as the endocrine pancreas in some type 1 diabetic patients
12788072 New functions of lactoferrin and beta-casein in mammalian milk as cysteine protease inhibitors. They might play a role in antiseptic and antiinfectious functions due to cysteine protease inhibition of bacteria and viruses.
12774664 The content of LTF was studied in the CSF and blood of patients with tick-borne encephalitis of the meningeal and focal types.
12646274 Arg 25 and Arg 28 are the critical basic residues at the lactoferrin N terminus responsible for heparin binding
12565886 Results identify the transcription start sites of the Delta lactoferrin (delta LF) in mammary gland and bone marrow and demonstrated that delta LF is the product of an alternative promoter present in the first intron of the lactoferrin gene.
12535064 conclude that lactoferrin is a serine protease capable of cleaving arginine-rich sequences; speculate that lactoferrin may cleave arginine-rich sequences in a variety of microbial virulence proteins, contributing to its antimicrobial properties
12525164 A highly amyloidogenic region of lactoferrin is reported and characterized (sequence of NAGDVAFV).
12450380 Three specific sites are variably occupied by polar groups in lactoferrin mutants R210G, R210E, and R210L and other Ltf proteins, which when coupled with iron-release data give new insights into factors that most influence iron retention at low pH.
12438385 LTF at concentration normally found in human colostrum blocks development of S. flexneri-induced inflammatory enteritis
12296849 The mechanism of action for lactoferrin contains a component for differential regulation of cellular immune responses during in vivo models of sepsis.
12165535 high-capacity multivalent metal-inducible mechanism for Fe acquisition from transferrin and lactoferrin
12165435 generated monoclonal antibodies (mAbs) to human lactoferrin as tools to assist both structure-function studies and the development of recombinant human lactoferrin for applications in human health care
12103434 A peptide derived from human lactoferricin inhibits HIV-1 RT activity in a dose-dependent manner
12097406 Lactotransferrin adherent to the surface epithelium may contribute to the activation of eosinophils that infiltrate the airway lumen.
12065686 Lactoferrin forms amyloid in the cornea in patients with lactoferrin mutation.However a heterozygotic Glu561Asp mutation appeared in 44.8% of healthy Japanese, suggesting that the mutation may not be essential for amyloid formation.
12037568 lactoferrin, a ubiquitous and abundant constituent of human external secretions, blocks biofilm development by the opportunistic pathogen Pseudomonas aeruginosa
11937551 Lactoferrin mediates both antimicrobial and immunomodulatory activities with downstream effects on the outcome of immune pathology in infectious and inflammatory disease.
11911118 Lactoferrin: influences on langerhans cells, epidermal cytokines, and cutaneous inflammation.
11908641 Studies of the ceruloplasmin-lactoferrin complex
11908638 genetic polymorphisms of the lactoferrin gene exist in selected exons and additional mutations of the lactoferrin gene do occur in the cancer cells
11787671 data demonstrate that human lactoferrin in the milk of transgenic dams promotes intestinal development of suckling neonates
11756570 Results show that lactoferrin gene expression is responsive to estrogen in the endometrium.
11748357 Observational study of gene-disease association. (HuGE Navigator)
11697537 has been found to possess antibacterial, antimycotic, antiviral, antineoplastic and anti-inflammatory activity
11675140 A peptide derived from human lactoferricin inhibits HIV-1 RT activity in a dose-dependent manner
11549422 Bacteriostatic activity of human lactoferrin against Staphylococcus aureus is a function of its iron-binding properties and is not influenced by antibiotic resistance.
9781360 A peptide derived from human lactoferricin inhibits HIV-1 RT activity in a dose-dependent manner

AA Sequence

MKLVFLVLLFLGALGLCLAGRRRSVQWCAVSQPEATKCFQWQRNMRKVRGPPVSCIKRDSPIQCIQAIAE      1 - 70
NRADAVTLDGGFIYEAGLAPYKLRPVAAEVYGTERQPRTHYYAVAVVKKGGSFQLNELQGLKSCHTGLRR     71 - 140
TAGWNVPIGTLRPFLNWTGPPEPIEAAVARFFSASCVPGADKGQFPNLCRLCAGTGENKCAFSSQEPYFS    141 - 210
YSGAFKCLRDGAGDVAFIRESTVFEDLSDEAERDEYELLCPDNTRKPVDKFKDCHLARVPSHAVVARSVN    211 - 280
GKEDAIWNLLRQAQEKFGKDKSPKFQLFGSPSGQKDLLFKDSAIGFSRVPPRIDSGLYLGSGYFTAIQNL    281 - 350
RKSEEEVAARRARVVWCAVGEQELRKCNQWSGLSEGSVTCSSASTTEDCIALVLKGEADAMSLDGGYVYT    351 - 420
AGKCGLVPVLAENYKSQQSSDPDPNCVDRPVEGYLAVAVVRRSDTSLTWNSVKGKKSCHTAVDRTAGWNI    421 - 490
PMGLLFNQTGSCKFDEYFSQSCAPGSDPRSNLCALCIGDEQGENKCVPNSNERYYGYTGAFRCLAENAGD    491 - 560
VAFVKDVTVLQNTDGNNNEAWAKDLKLADFALLCLDGKRKPVTEARSCHLAMAPNHAVVSRMDKVERLKQ    561 - 630
VLLHQQAKFGRNGSDCPDKFCLFQSETKNLLFNDNTECLARLHGKTTYEKYLGPQYVAGITNLKKCSTSP    631 - 700
LLEACEFLRK                                                                701 - 710
//

Text Mined References (256)

PMID Year Title
26649297 2015 A Novel Murine Anti-Lactoferrin Monoclonal Antibody Activates Human Polymorphonuclear Leukocytes through Membrane-Bound Lactoferrin and TLR4.
26469086 2016 The effect of recombinant human lactoferrin from the milk of transgenic cows on Salmonella enterica serovar typhimurium infection in mice.
26445132 2015 Effects of lactoferrin, a protein present in the female reproductive tract, on parameters of human sperm capacitation and gamete interaction.
26405758 2016 Expression, purification, and breast cancer cell inhibiting effect of recombinant human lactoferrin C-lobe.
26366224 2015 Tear lipocalin, lysozyme and lactoferrin concentrations in postmenopausal women.
26279447 2015 Lactoferrin Inhibits IL-1?-Induced Chondrocyte Apoptosis Through AKT1-Induced CREB1 Activation.
25946246 2015 Lactotransferrin gene functional polymorphisms do not influence susceptibility to human immunodeficiency virus-1 mother-to-child transmission in different ethnic groups.
25946035 2015 Human Basal Tear Peptidome Characterization by CID, HCD, and ETD Followed by in Silico and in Vitro Analyses for Antimicrobial Peptide Identification.
25916224 2015 Consecutive Monitoring of Fecal Calprotectin and Lactoferrin for the Early Diagnosis and Prediction of Pouchitis after Restorative Proctocolectomy for Ulcerative Colitis.
25914748 Correlations between eyelid tumors and tear lipocalin, lysozyme and lactoferrin concentrations in postmenopausal women.
25784250 2015 Lactoferrin: A Roadmap to the Borderland between Caries and Periodontal Disease.
25405719 2015 Calprotectin and lactoferrin in the cerebrospinal fluid; biomarkers utilisable for differential diagnostics of bacterial and aseptic meningitis?
25340798 2014 Genome-wide association study of CSF levels of 59 alzheimer's disease candidate proteins: significant associations with proteins involved in amyloid processing and inflammation.
25286756 2015 Lactotransferrin could be a novel independent molecular prognosticator of nasopharyngeal carcinoma.
25236863 2015 Generation of bi-transgenic pigs overexpressing human lactoferrin and lysozyme in milk.
25193851 2014 The intracellular inhibition of HCV replication represents a novel mechanism of action by the innate immune Lactoferrin protein.
25057912 2014 Lactoferrin deficiency promotes colitis-associated colorectal dysplasia in mice.
24970346 2014 Correlation between lactoferrin and beneficial microbiota in breast milk and infant's feces.
24831229 2014 Fecal lactoferrin and intestinal permeability are effective non-invasive markers in the diagnostic work-up of chronic diarrhea.
24571258 2014 Lactoferrin gene knockdown leads to similar effects to iron chelation in human adipocytes.
24442915 2014 Monitoring lactoferrin iron levels by fluorescence resonance energy transfer: a combined chemical and computational study.
24340941 2013 [The dynamics of changes in lysozyme activity and content of lactoferrin content of patients with chronic osteomyelitis].
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24217007 2014 Lack of association between lactotransferrin polymorphism and dental caries.
24077968 2013 The iron-binding protein lactoferrin protects vulnerable dopamine neurons from degeneration by preserving mitochondrial calcium homeostasis.
23580065 2013 Shotgun proteomics reveals specific modulated protein patterns in tears of patients with primary open angle glaucoma naïve to therapy.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23479198 2013 miR-214 promotes tumorigenesis by targeting lactotransferrin in nasopharyngeal carcinoma.
23460521 2013 A lactotransferrin single nucleotide polymorphism demonstrates biological activity that can reduce susceptibility to caries.
23427237 2013 A protein isolated from human oviductal tissue in vitro secretion, identified as human lactoferrin, interacts with spermatozoa and oocytes and modulates gamete interaction.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23333090 2013 Study of lactoferrin gene expression in human and mouse adipose tissue, human preadipocytes and mouse 3T3-L1 fibroblasts. Association with adipogenic and inflammatory markers.
23069661 2013 Lactotransferrin acts as a tumor suppressor in nasopharyngeal carcinoma by repressing AKT through multiple mechanisms.
22900286 2003 Crystal structure of human seminal diferric lactoferrin at 3.4 Angstrom resolution.
22806010 2012 Human lactoferrin increases Helicobacter pylori internalisation into AGS cells.
22763972 2012 Decrease in salivary lactoferrin output in chronically intoxicated alcohol-dependent patients.
22731992 2012 Lactoferrin regulates an axis involving CD11b and CD49d integrins and the chemokines MIP-1? and MCP-1 in GM-CSF-treated human primary eosinophils.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
22553915 2012 Lactoferrin: an alternative view of its role in human biological fluids.
22523385 2012 The human lactoferrin-derived peptide hLF1-11 exerts immunomodulatory effects by specific inhibition of myeloperoxidase activity.
22433582 2012 Inhibition of Epstein-Barr virus infection by lactoferrin.
22406253 2012 Functional polymorphisms in the LTF gene and risk of coronary artery stenosis.
22380846 2012 Endocytosis and trafficking of human lactoferrin in macrophage-like human THP-1 cells (1).
22377758 2012 Cloning a human saliva-derived peptide for preventing KSHV transmission.
22320386 2012 Delta-lactoferrin, an intracellular lactoferrin isoform that acts as a transcription factor.
22261723 2012 Glycosylation of human milk lactoferrin exhibits dynamic changes during early lactation enhancing its role in pathogenic bacteria-host interactions.
22226679 2012 Human lactoferrin suppresses TNF-?-induced intercellular adhesion molecule-1 expression via competition with NF-?B in endothelial cells.
22173721 2012 Association of the -33C/G OSF-2 and the 140A/G LF gene polymorphisms with the risk of chronic rhinosinusitis with nasal polyps in a Polish population.
22011934 2012 Risk of nasopharyngeal carcinoma associated with polymorphic lactotransferrin haplotypes.
22006997 2011 Lactoferrin-endothelin-1 axis contributes to the development and invasiveness of triple-negative breast cancer phenotypes.
21937479 2011 The relationship of haplotype in lactotransferrin and its expression levels in Chinese Han ovarian cancer.
21935933 2011 Apo- and holo-lactoferrin are both internalized by lactoferrin receptor via clathrin-mediated endocytosis but differentially affect ERK-signaling and cell proliferation in Caco-2 cells.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21572958 2011 Multiplex immunoassay of lower genital tract mucosal fluid from women attending an urban STD clinic shows broadly increased IL1ß and lactoferrin.
21525168 2011 Identification of increased amounts of eppin protein complex components in sperm cells of diabetic and obese individuals by difference gel electrophoresis.
21502085 2011 Genome-wide association study implicates PARD3B-based AIDS restriction.
21400573 2011 Underlying mechanisms for LTF inactivation and its functional analysis in nasopharyngeal carcinoma cell lines.
21269460 2011 Initial characterization of the human central proteome.
21163060 2010 [Expression, genetic and epigenetic alterations of LTF gene in nasopharyngeal carcinoma cell lines].
21055448 2011 Recognition roles of the carbohydrate glycotopes of human and bovine lactoferrins in lectin-N-glycan interactions.
20972893 2011 Does lactoferrin behave as an immunohistochemical oncofetal marker in bone and cartilage human neoplasms?
20963400 2011 The relationship of fetuin-A and lactoferrin with bone mass in elderly women.
20922188 2010 Faecal lactoferrin, capsule endoscopy and Crohn's disease. Is there a three way relationship? A pilot study.
20673868 2010 A genetic association study of maternal and fetal candidate genes that predispose to preterm prelabor rupture of membranes (PROM).
20668874 2010 Relationships among salivary immunoglobulin A, lactoferrin and cortisol in basketball players during a basketball season.
20598696 2010 Lactoferrin is a novel predictor of fatal ischemic heart disease in diabetes mellitus type 2: long-term follow-up of the HUNT 1 study.
20594128 2010 Clinical utility of calprotectin and lactoferrin as markers of inflammation in patients with inflammatory bowel disease.
20587610 2010 Examination of genetic polymorphisms in newborns for signatures of sex-specific prenatal selection.
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
20485928 Analysis of the association between lactotransferrin (LTF) gene polymorphism and dental caries.
20452482 2010 Identification of fetal and maternal single nucleotide polymorphisms in candidate genes that predispose to spontaneous preterm labor with intact membranes.
20411301 2010 E2F1-directed activation of Bcl-2 is correlated with lactoferrin-induced apoptosis in Jurkat leukemia T lymphocytes.
20404350 2010 O-GlcNAcylation/phosphorylation cycling at Ser10 controls both transcriptional activity and stability of delta-lactoferrin.
20401683 2010 Positive selection drives lactoferrin evolution in mammals.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20345905 2010 Human lactoferrin activates NF-kappaB through the Toll-like receptor 4 pathway while it interferes with the lipopolysaccharide-stimulated TLR4 signaling.
20238236 2010 The human lactoferrin-derived peptide hLF1-11 primes monocytes for an enhanced TLR-mediated immune response.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20207115 2010 Charge reversal by salt-induced aggregation in aqueous lactoferrin solutions.
20155438 2010 Periodontitis, periodontopathic bacteria and lactoferrin.
20136960 2009 Fecal lactoferrin, myeloperoxidase and serum C-reactive are effective biomarkers in the assessment of disease activity and severity in patients with idiopathic ulcerative colitis.
19997820 2009 Immunolocalization of lactoferrin in cartilage-forming neoplasms.
19916937 2009 Study of interaction of ceruloplasmin, lactoferrin, and myeloperoxidase by photon correlation spectroscopy.
19834535 2009 Sequential use of transcriptional profiling, expression quantitative trait mapping, and gene association implicates MMP20 in human kidney aging.
19651866 2009 Flagellum-mediated biofilm defense mechanisms of Pseudomonas aeruginosa against host-derived lactoferrin.
19563039 2009 [Relationship of concentration of lactoferrin and lysozyme in saliva and dental caries in primary dentition].
19454813 2009 Lactoferrin in chronic pancreatitis.
19435495 2009 Human lactoferrin but not lysozyme neutralizes HSV-1 and inhibits HSV-1 replication and cell-to-cell spread.
19382280 DNA, oligosaccharides, and mononucleotides stimulate oligomerization of human lactoferrin.
19348738 2009 Expression and localization of lactotransferrin messenger RNA in the cortex of Alzheimer's disease.
19334538 [DNA and oligosaccharides stimulate oligomerization of human milk lactoferrin].
19282435 2009 Adenovirus serotype 5 infects human dendritic cells via a coxsackievirus-adenovirus receptor-independent receptor pathway mediated by lactoferrin and DC-SIGN.
19258923 2009 Genetic susceptibility to respiratory syncytial virus bronchiolitis in preterm children is associated with airway remodeling genes and innate immune genes.
19240970 2009 Lactoferrin immuno-expression in human normal and neoplastic bone tissue.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19033648 2009 Apoptotic human cells inhibit migration of granulocytes via release of lactoferrin.
18977241 2008 Oxidative stress, telomere length and biomarkers of physical aging in a cohort aged 79 years from the 1932 Scottish Mental Survey.
18973542 2009 Association between lactoferrin gene polymorphisms and aggressive periodontitis among Taiwanese patients.
18785755 2008 The N1 domain of human lactoferrin is required for internalization by caco-2 cells and targeting to the nucleus.
18780401 2008 Identification of N-linked glycoproteins in human milk by hydrophilic interaction liquid chromatography and mass spectrometry.
18714013 2008 The major bactericidal activity of human seminal plasma is zinc-dependent and derived from fragmentation of the semenogelins.
18697201 2008 Lactotransferrin: a candidate tumor suppressor-Deficient expression in human nasopharyngeal carcinoma and inhibition of NPC cell proliferation by modulating the mitogen-activated protein kinase pathway.
18619616 2008 Talactoferrin stimulates wound healing with modulation of inflammation.
18573312 2009 Antimicrobial properties of lactoferrin.
18453607 2008 Lactoferrin acts as an alarmin to promote the recruitment and activation of APCs and antigen-specific immune responses.
18285402 2008 The secretory leukocyte protease inhibitor (SLPI) and the secondary granule protein lactoferrin are synthesized in myelocytes, colocalize in subcellular fractions of neutrophils, and are coreleased by activated neutrophils.
18183929 2008 Lactoferrin structure and functions.
18156281 2008 Association of circulating lactoferrin concentration and 2 nonsynonymous LTF gene polymorphisms with dyslipidemia in men depends on glucose-tolerance status.
18022620 2008 Lactoferrin Glu561Asp polymorphism is associated with susceptibility to herpes simplex keratitis.
17947640 2007 A distinct role of neutrophil lactoferrin in RelA/p65 phosphorylation on Ser536 by recruiting TNF receptor-associated factors to IkappaB kinase signaling complex.
17703412 2007 Genetic susceptibility to respiratory syncytial virus bronchiolitis is predominantly associated with innate immune genes.
17601350 2007 A genetic association analysis of cognitive ability and cognitive ageing using 325 markers for 109 genes associated with oxidative stress or cognition.
17597152 2007 Structural characterization of the ceruloplasmin: lactoferrin complex in solution.
17568188 2007 Silencing of Lactotransferrin expression by methylation in prostate cancer progression.
17567961 2007 Characterization of an eppin protein complex from human semen and spermatozoa.
17543335 2007 Structure of a complex of human lactoferrin N-lobe with pneumococcal surface protein a provides insight into microbial defense mechanism.
17515863 2007 Lactoferrin induces concentration-dependent functional modulation of intestinal proliferation and differentiation.
17503830 2007 A calorimetric study of thermal denaturation of recombinant human lactoferrin from rice.
17481742 2007 The anti-papillomavirus activity of human and bovine lactoferricin.
17476971 2006 Genetic and epigenetic alterations of LTF at 3p21.3 in nasopharyngeal carcinoma.
17475866 2007 Human polymorphonuclear leukocytes inhibit Aspergillus fumigatus conidial growth by lactoferrin-mediated iron depletion.
17461450 2007 Usefulness of fecal lactoferrin and hemoglobin in diagnosis of colorectal diseases.
17390038 2007 Immunoexpression of lactoferrin in human sporadic renal cell carcinomas.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17342646 2007 A novel single-nucleotide polymorphism in the lactoferrin gene is associated with susceptibility to diarrhea in North American travelers to Mexico.
17263370 2007 The acyl group as the central element of the structural organization of antimicrobial lipopeptide.
17211147 2007 Effects of iron-unsaturated human lactoferrin on hydrogen peroxide-induced oxidative damage in intestinal epithelial cells.
17208010 2007 High-level expression of human lactoferrin in the milk of goats by using replication-defective adenoviral vectors.
17079302 2007 Adenoviruses use lactoferrin as a bridge for CAR-independent binding to and infection of epithelial cells.
17030385 2007 Cleaved inflammatory lactoferrin peptides in parotid saliva of periodontitis patients.
17015741 2006 Differential modulation of human lactoferrin activity against both R5 and X4-HIV-1 adsorption on epithelial cells and dendritic cells by natural antibodies.
16954396 2006 Transgenic cows that produce recombinant human lactoferrin in milk are not protected from experimental Escherichia coli intramammary infection.
16936811 2006 Single nucleotide polymorphisms (SNPs) in human lactoferrin gene.
16936805 2006 Human lactoferrin controls the level of retinoblastoma protein and its activity.
16936800 2006 Lactoferrin and bone; structure-activity relationships.
16842782 2006 Human lactoferrin upregulates expression of KDR/Flk-1 and stimulates VEGF-A-mediated endothelial cell proliferation and migration.
16820307 2006 Induction of lactoferrin and IL-8 release from human neutrophils by tryptic enzymes via proteinase activated receptor-2.
16787913 2006 Interaction of human lactoferrin with cell adhesion molecules through RGD motif elucidated by lactoferrin-binding epitopes.
16769765 2006 Release of surface-expressed lactoferrin from polymorphonuclear neutrophils after contact with CD4+ T cells and its modulation on Th1/Th2 cytokine production.
16650524 2006 Lactoferrin potently inhibits osteoblast apoptosis, via an LRP1-independent pathway.
16644090 2007 Decreased lactoferrin levels in peritoneal fluid of women with minimal endometriosis.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16502470 2006 Human colostrum: identification of minor proteins in the aqueous phase by proteomics.
16432833 2006 Down regulation of 3p genes, LTF, SLC38A3 and DRR1, upon growth of human chromosome 3-mouse fibrosarcoma hybrids in severe combined immunodeficiency mice.
16261256 2005 Multifunctional roles of lactoferrin: a critical overview.
16261253 2005 Lactoferrin: an important host defence against microbial and viral attack.
16208406 2005 A non-conservative, coding single-nucleotide polymorphism in the N-terminal region of lactoferrin is associated with aggressive periodontitis in an African-American, but not a Caucasian population.
16201406 2005 The protein structure of recombinant human lactoferrin produced in the milk of transgenic cows closely matches the structure of human milk-derived lactoferrin.
16152584 2006 Genetic and epigenetic inactivation of LTF gene at 3p21.3 in lung cancers.
16048952 2005 Human lactoferricin is partially folded in aqueous solution and is better stabilized in a membrane mimetic solvent.
15993972 2005 High level expression of functionally active human lactoferrin in silkworm larvae.
15955101 2005 Salivary lactoferrin is recognized by the human herpesvirus-8.
15851553 2005 The lacrimal gland transcriptome is an unusually rich source of rare and poorly characterized gene transcripts.
15793153 2005 Antibiotic tolerance induced by lactoferrin in clinical Pseudomonas aeruginosa isolates from cystic fibrosis patients.
15687491 2005 Structural origin of endotoxin neutralization and antimicrobial activity of a lactoferrin-based peptide.
15543612 2005 Expression and prognostic value of lactoferrin mRNA isoforms in human breast cancer.
15525592 2004 Estrogen response element and the promoter context of the human and mouse lactoferrin genes influence estrogen receptor alpha-mediated transactivation activity in mammary gland cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15378004 2004 Neutrophil lactoferrin upregulates the human p53 gene through induction of NF-kappaB activation cascade.
15364102 2004 Effects of human lactoferrin on the cytoplasmic membrane of Candida albicans cells related with its candidacidal activity.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15299793 1995 Structure of human diferric lactoferrin refined at 2.2 A resolution.
15299444 1994 Structure of copper- and oxalate-substituted human lactoferrin at 2.0 A resolution.
15297857 2004 Steady-state plasma lactoferrin levels in relation to infections and complications of sickle cell disease.
15222485 2004 Expression of delta-lactoferrin induces cell cycle arrest.
15222484 2004 Methylation and expression of the lactoferrin gene in human tissues and cancer cells.
15221967 2004 Oral lactoferrin inhibits growth of established tumors and potentiates conventional chemotherapy.
15166119 2004 Lactoferrin is a potent regulator of bone cell activity and increases bone formation in vivo.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14573629 2003 One of two human lactoferrin variants exhibits increased antibacterial and transcriptional activation activities and is associated with localized juvenile periodontitis.
12826902 2003 High prevalence of autoantibodies against carbonic anhydrase II and lactoferrin in type 1 diabetes: concept of autoimmune exocrinopathy and endocrinopathy of the pancreas.
12788072 2003 New functions of lactoferrin and beta-casein in mammalian milk as cysteine protease inhibitors.
12774664 2003 [Lactoferrin and its role in the pathogenesis of tick-borne encephalitis].
12766201 2003 MG2 and lactoferrin form a heterotypic complex in salivary secretions.
12710738 Lactoferrin-protector against oxidative stress and regulator of glycolysis in human erythrocytes.
12693969 2003 Potassium efflux induced by a new lactoferrin-derived peptide mimicking the effect of native human lactoferrin on the bacterial cytoplasmic membrane.
12646274 2003 Arginine 25 and Arginine 28 of lactoferrin are critical for effective heparin neutralization in blood.
12565886 2003 An intronic alternative promoter of the human lactoferrin gene is activated by Ets.
12563088 2003 Effect of exercise on immunologic factors in breast milk.
12535064 2003 Human milk lactoferrin is a serine protease that cleaves Haemophilus surface proteins at arginine-rich sites.
12525164 2003 In vitro characterization of lactoferrin aggregation and amyloid formation.
12522210 2003 Identification of a lactoferrin-derived peptide possessing binding activity to hepatitis C virus E2 envelope protein.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12450380 2002 "Dilysine trigger" in transferrins probed by mutagenesis of lactoferrin: crystal structures of the R210G, R210E, and R210L mutants of human lactoferrin.
12438385 2002 Lactoferrin protects rabbits from Shigella flexneri-induced inflammatory enteritis.
12296849 2002 Differential effects of prophylactic, concurrent and therapeutic lactoferrin treatment on LPS-induced inflammatory responses in mice.
12165535 2002 Multivalent metal-induced iron acquisition from transferrin and lactoferrin by myeloid cells.
12165435 2002 Characterization of monoclonal antibodies against human lactoferrin.
12097406 2002 Immobilized lactoferrin is a stimulus for eosinophil activation.
12037568 2002 A component of innate immunity prevents bacterial biofilm development.
12037297 2002 Structure of a domain-opened mutant (R121D) of the human lactoferrin N-lobe refined from a merohedrally twinned crystal form.
11937551 2002 Enhanced Th1 response to Staphylococcus aureus infection in human lactoferrin-transgenic mice.
11911118 2002 Lactoferrin: influences on Langerhans cells, epidermal cytokines, and cutaneous inflammation.
11908641 2002 Studies of the ceruloplasmin-lactoferrin complex.
11908638 2002 Detection of exon polymorphisms in the human lactoferrin gene.
11907569 2002 Killing activity of neutrophils is mediated through activation of proteases by K+ flux.
11748357 2001 Is tumor necrosis factor genotype (TNFA2/TNFA2)a genetic prognostic factor of an unfavorable outcome in IgA nephropathy?
11730482 2001 Identification of an import signal for, and the nuclear localization of, human lactoferrin.
11702692 2001 [cDNA cloning and sequence analysis of human lactoferrin].
11238676 2001 A milk protein lactoferrin enhances human T cell leukemia virus type I and suppresses HIV-1 infection.
11179314 2001 Human lactoferrin and peptides derived from its N terminus are highly effective against infections with antibiotic-resistant bacteria.
11128996 2000 Metal substitution in transferrins: specific binding of cerium(IV) revealed by the crystal structure of cerium-substituted human lactoferrin.
11083760 2000 Human lactoferrin interacts with soluble CD14 and inhibits expression of endothelial adhesion molecules, E-selectin and ICAM-1, induced by the CD14-lipopolysaccharide complex.
11083624 2000 Candidacidal activities of human lactoferrin peptides derived from the N terminus.
10944471 2000 Surface expression of lactoferrin by resting neutrophils.
10828980 2000 Crystal structure and iron-binding properties of the R210K mutant of the N-lobe of human lactoferrin: implications for iron release from transferrins.
10792619 2000 Expression of lactoferrin in the kidney: implications for innate immunity and iron metabolism.
10666301 2000 Interaction of lactoferrin with ceruloplasmin.
10558865 1999 Interaction of tear lipocalin with lysozyme and lactoferrin.
10340976 1999 Decreased tear lactoferrin concentration in patients with chronic hepatitis C.
10089508 1998 Structure of human apolactoferrin at 2.0 A resolution. Refinement and analysis of ligand-induced conformational change.
10089347 1999 Structure of recombinant human lactoferrin expressed in Aspergillus awamori.
9895117 1998 Structure of the human lactoferrin gene and its chromosomal localization.
9873069 1998 Familial subepithelial corneal amyloidosis (gelatinous drop-like corneal dystrophy): exclusion of linkage to lactoferrin gene.
9770539 1998 Human milk lactoferrin inactivates two putative colonization factors expressed by Haemophilus influenzae.
9359845 1997 N-terminal stretch Arg2, Arg3, Arg4 and Arg5 of human lactoferrin is essential for binding to heparin, bacterial lipopolysaccharide, human lysozyme and DNA.
9223490 1997 Hepatitis C virus envelope proteins bind lactoferrin.
9122171 1997 Identification of an alternative form of human lactoferrin mRNA that is expressed differentially in normal tissues and tumor-derived cell lines.
9003186 1997 Mutagenesis of the histidine ligand in human lactoferrin: iron binding properties and crystal structure of the histidine-253-->methionine mutant.
8931543 1996 Mutation of arginine 121 in lactoferrin destabilizes iron binding by disruption of anion binding: crystal structures of R121S and R121E mutants.
8870657 1996 Heterogeneity in utilization of N-glycosylation sites Asn624 and Asn138 in human lactoferrin: a study with glycosylation-site mutants.
8703903 1996 Anion binding by transferrins: importance of second-shell effects revealed by the crystal structure of oxalate-substituted diferric lactoferrin.
8594202 1996 Altered domain closure and iron binding in transferrins: the crystal structure of the Asp60Ser mutant of the amino-terminal half-molecule of human lactoferrin.
8551695 1995 Characterization of the 84-kDa protein with ABH activity in human seminal plasma.
8371268 1993 Structure of the recombinant N-terminal lobe of human lactoferrin at 2.0 A resolution.
8162571 1994 Human lactoferrin inhibits growth of solid tumors and development of experimental metastases in mice.
8089135 1994 Delineation of the glycosaminoglycan-binding site in the human inflammatory response protein lactoferrin.
8069634 1994 Structures of a legume lectin complexed with the human lactotransferrin N2 fragment, and with an isolated biantennary glycopeptide: role of the fucose moiety.
7762432 1994 Antimicrobial peptides of lactoferrin.
7744878 1995 Lactoferrin down-modulates the activity of the granulocyte macrophage colony-stimulating factor promoter in interleukin-1 beta-stimulated cells.
7049727 1982 An 88 amino acid long C-terminal sequence of human lactotransferrin.
6802759 1982 Bactericidal activity of human lactoferrin: differentiation from the stasis of iron deprivation.
6794640 1981 The present state of the human lactotransferrin sequence. Study and alignment of the cyanogen bromide fragments and characterization of N- and C-terminal domains.
6510420 1984 Human lactotransferrin: amino acid sequence and structural comparisons with other transferrins.
3995055 1985 The interaction between human pancreatic carboxylester hydrolase (bile-salt-stimulated lipase of human milk) and lactoferrin.
3478818 1987 Assignment of the lactotransferrin gene to human chromosome 3 and to mouse chromosome 9.
3477300 1987 Isolation of lactoferrin cDNA from a human myeloid library and expression of mRNA during normal and leukemic myelopoiesis.
3356163 1988 Chromosomal localization of human lactotransferrin gene (LTF) by in situ hybridization.
3169987 1988 Damage of the outer membrane of enteric gram-negative bacteria by lactoferrin and transferrin.
3028636 1987 Immunocytochemical localization of lactoferrin in human neutrophils. An ultrastructural and morphometrical study.
2981589 1985 Ultrastructural localization of lactoferrin and myeloperoxidase in human neutrophils by immunogold.
2585506 1989 Structure of human lactoferrin: crystallographic structure analysis and refinement at 2.8 A resolution.
2402455 1990 Complete nucleotide sequence of human mammary gland lactoferrin.
2374734 1990 Nucleotide sequence of human lactoferrin cDNA.
2049066 1991 Expression of cloned human lactoferrin in baby-hamster kidney cells.
1772635 1991 Molecular replacement solution of the structure of apolactoferrin, a protein displaying large-scale conformational change.
1703177 1991 Regulation of human bone marrow lactoferrin and myeloperoxidase gene expression by tumor necrosis factor-alpha.
1661314 1991 Uptake of lactoferrin by mononuclear phagocytes inhibits their ability to form hydroxyl radical and protects them from membrane autoperoxidation.
1599934 1992 Identification of the bactericidal domain of lactoferrin.
1581307 1992 Metal substitution in transferrins: the crystal structure of human copper-lactoferrin at 2.1-A resolution.
1544444 1992 Interaction of calmodulin with lactoferrin.
1480183 1992 Differential molecular mechanism of the estrogen action that regulates lactoferrin gene in human and mouse.
1464627 1992 Low density lipoprotein receptor-related protein and gp330 bind similar ligands, including plasminogen activator-inhibitor complexes and lactoferrin, an inhibitor of chylomicron remnant clearance.
1369293 1990 Isolation and characterization of opioid antagonist peptides derived from human lactoferrin.
1327110 1992 Molecular interactions between human lactotransferrin and the phytohemagglutinin-activated human lymphocyte lactotransferrin receptor lie in two loop-containing regions of the N-terminal domain I of human lactotransferrin.