Property Summary

NCBI Gene PubMed Count 87
PubMed Score 91.33
PubTator Score 210.30

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
Asthma, Aspirin-Induced 13
Drug allergy 36
Disease Target Count Z-score Confidence
Asthma 349 5.184 2.6
Urticaria 53 3.718 1.9
Disease Target Count
Leukotriene C4 Synthase Deficiency 1

Protein-protein Interaction (9)

Gene RIF (80)

PMID Text
24366866 Biochemical and structural characterization of LTC4S mutants along with crystal structures of the wild type and mutated enzymes in complex with three product analogs, provide new insights to binding of substrates and product.
23889244 Elevated levels of leukotriene C4 synthase mRNA distinguish a subpopulation of eosinophilic oesophagitis patients.
23828562 The results of our study failed to confirm whether the selected variants in LTC4S gene within the LT metabolism pathway contribute to platelet reactivity in a diabetic population treated with ASA.
23079278 genetic association studies in population of Han Chinese in Eastern China: Data suggest that an SNP in LTC4S (rs730012) is associated with risk of ischemic stroke; carriers of C allele of rs730012 in LTC4S are most susceptible to ischemic stroke.
22884858 meta-analysis suggested that the -444A/C polymorphism in the LTC4S gene would be a risk factor for asthma in Caucasians and aspirin-tolerant populations
22722751 A significant association has been found between the -1072G/A (rs3776944) SNP in the LTC4S gene and atopic asthma in the family-based analysis.
22217203 investigation of catalytic mechanism of LTC4S: Data suggest that glutathione thiolate anion formation in LTC4S is not rate-limiting for overall reaction of leukotriene C4 production. Thiolate anion is stabilized by Arg104 at all three active sites.
21729626 The SNPs of ALOX(5)AP and LTC(4)S are associated with asthma.
21454538 The catalytic architecture of leukotriene C4 synthase with two arginine residues.
21307858 Polymorphisms of the PTGDR and LTC4S influence responsiveness to leukotriene receptor antagonists in Korean children with asthma.
21078989 The increased expression of LTC(4)S, together with the predominant formation of cysteinyl-leukotrienes and effects on MMPs production, suggests a mechanism by which LTs may promote matrix degradation in the AAA wall
20980252 Arginine 104 is a key catalytic residue in leukotriene C4 synthase.
20603037 Observational study of gene-disease association. (HuGE Navigator)
20536507 Observational study of gene-disease association. (HuGE Navigator)
20456754 Observational study of gene-disease association. (HuGE Navigator)
20395963 Observational study of gene-disease association. (HuGE Navigator)
20128419 no association between gene polymorphism and bronchial asthma in a Spanish population
19956635 Uncategorized study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19862937 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19703064 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19559392 Observational study of gene-disease association. (HuGE Navigator)
19524426 Observational study of gene-disease association. (HuGE Navigator)
19479237 Observational study of gene-disease association. (HuGE Navigator)
19450127 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19280718 Leukotriene C4 synthase promoter genotypes influence risk of transient ischemic attack and ischemic stroke, but not risk of ischemic heart disease/coronary atherosclerosis, asthma, or chronic obstructive pulmonary disease.
19280718 Observational study of gene-disease association. (HuGE Navigator)
19263529 Observational study of gene-disease association. (HuGE Navigator)
19247692 Observational study of gene-disease association. (HuGE Navigator)
19233132 LTC(4)S interacts in vitro with both FLAP and 5-LO and that these interactions involve distinct parts of LTC(4)S.
19223558 Observational study of gene-disease association. (HuGE Navigator)
19214143 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19131662 Meta-analysis of gene-disease association. (HuGE Navigator)
19131661 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19080797 The combined study of polymorphisms in genes of the leukotriene pathway could explain the differences observed in the studies reported on polymorphism -444A < C LTC4S individually analysed.
19080797 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19080532 In a Southwest Chinese Han population LTC(4)S A(-444)C polymorphism might be a determinant factor in the clinical response of asthma to leukotriene receptor antagonists.
19080532 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19028820 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18974840 Observational study of gene-disease association. (HuGE Navigator)
18366797 Observational study of gene-disease association. (HuGE Navigator)
18323512 Genetic variation in leukotriene pathway members and their receptors confer an increased risk of ischemic stroke in 2 independent populations
18276912 Leukotriene C(4) synthase -1072 AA genotype predict increased risk, whereas -444 CC genotype predict decreased risk of ischemic cerebrovascular disease.
18276912 Observational study of gene-disease association. (HuGE Navigator)
17924829 Observational study of gene-gene interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17883728 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17632548 atomic structure of human LTC4S in a complex with glutathione at 3.3 A resolution by X-ray crystallography
17632546 crystal structure of the human LTC4 synthase in its apo and GSH-complexed forms to 2.00 and 2.15 A resolution, respectively
17483957 The results of a case-control study aimed at investigating the association of MGST1 gene locus polymorphisms with colorectal cancer risk among Han Chinese are presented.
17460547 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17291864 Observational study of gene-disease association. (HuGE Navigator)
17153879 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17153879 The combination of 927T CYSLTR1 and -444A LTC4S was less common in male patients with asthma than in controls and the combination of 927C CYSLTR1 and -444A LTC4S was slightly more frequent in patients with asthma
17110605 Observational study of gene-disease association. (HuGE Navigator)
17110605 LTC4S plays a key role in the process of inflammation as the rate limiting enzyme in the conversion of arachidonic acid to cysteinyl-leukotrienes, important mediators of inflammatory responses.
17063752 Observational study of gene-disease association. (HuGE Navigator)
16730545 Observational study of gene-disease association. (HuGE Navigator)
16675353 The C allele of the leukotriene C4 synthase (A-444C) polymorphism is associated with asthma phenotype or severity.
16340173 Observational study of gene-disease association. (HuGE Navigator)
16293801 Observational study of gene-disease association. (HuGE Navigator)
16211251 Observational study of gene-disease association. (HuGE Navigator)
16211251 Glu 4 Lys amino acid substitution in the LTC4S might be associated with allergic diseases.
16024972 Observational study of gene-disease association. (HuGE Navigator)
16024972 leukotriene C4 synthase gene promoter polymorphism is associated with asthma and/or atopy
15530365 calculated a projection map of recombinant human LTC(4) synthase at a resolution of 4.5 A by electron crystallography
15131571 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
15131571 independent of transcriptional activity, the C(-444) allele in the LTC(4) synthase gene is weakly associated with the asthma phenotype, but it is not related to disease severity or aspirin intolerance
14749922 Observational study of gene-disease association. (HuGE Navigator)
14520724 We further conclude that the A(-444)C polymorphism in the LTC(4) synthase gene probably contributes to asthma interpatient variability in montelukast-evoked changes in FE(NO)* and warrants further study.
12968987 Clinical trial and meta-analysis of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12816731 Data show that mucosal mast cells, and not eosinophils, were the dominating leukotriene C4 synthase-containing cells in both untreated and treated aspirin-tolerant asthma.
12728163 Observational study of gene-disease association. (HuGE Navigator)
12664565 Gene expression in mononuclear phagocytes is regulated by SP1 and SP3.
12591277 expression of LTC(4)S during normal and leukemic myelopoiesis and correlation with the activity of the disease-specific tyrosine kinase p210 BCR-ABL in CML myeloid cells.
12589355 C-to-A promoter polymorphism was associated with the increased presence of chronic hyperplastic eosinophilic sinusitis and the expression of cysteinyl leukotrienes
12360108 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12360108 A(-444)C polymorphism of this gene and clinical response to pranlukast in Japanses patients with moderate asthma
12063521 Observational study of gene-disease association. (HuGE Navigator)
12063521 no relationship between the polymorphism and LTC4S activity in eosinophils, although LTC4S activities were significantly higher in patients with aspirin induced asthma than in patients with aspirin tolerant asthma
11934880 Distinct roles of receptor phosphorylation, G protein usage, and mitogen-activated protein kinase activation on platelet activating factor-induced leukotriene C(4) generation
11770699 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVA      1 - 70
GIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALL     71 - 140
GRLRTLLPWA                                                                141 - 150
//

Text Mined References (91)

PMID Year Title
24366866 2014 Crystal structures of leukotriene C4 synthase in complex with product analogs: implications for the enzyme mechanism.
23889244 2013 Elevated levels of leukotriene C4 synthase mRNA distinguish a subpopulation of eosinophilic oesophagitis patients.
23828562 2013 Lack of effect of common single nucleotide polymorphisms in leukotriene pathway genes on platelet reactivity in patients with diabetes.
23079278 2012 Genetic variation in members of the leukotrienes biosynthesis pathway confers risk of ischemic stroke in Eastern Han Chinese.
22884858 2012 The -444A/C polymorphism in the LTC4S gene and the risk of asthma: a meta-analysis.
22722751 2012 Association of the -1072G/A polymorphism in the LTC4S gene with asthma in an Indian population.
22217203 2012 Pre-steady-state kinetic characterization of thiolate anion formation in human leukotriene C? synthase.
21729626 2011 [Association of leukotriene gene polymorphisms with response to antileukotriene treatment in patients with asthma].
21454538 2011 The catalytic architecture of leukotriene C4 synthase with two arginine residues.
21307858 2011 Polymorphisms of the PTGDR and LTC4S influence responsiveness to leukotriene receptor antagonists in Korean children with asthma.
21078989 2010 Increased expression of leukotriene C4 synthase and predominant formation of cysteinyl-leukotrienes in human abdominal aortic aneurysm.
20980252 2010 Arginine 104 is a key catalytic residue in leukotriene C4 synthase.
20603037 2010 Single nucleotide polymorphisms in inflammation-related genes are associated with venous thromboembolism.
20536507 2010 Independent predictive roles of eotaxin Ala23Thr, paraoxonase 2 Ser311Cys and beta-adrenergic receptor Trp64Arg polymorphisms on cardiac disease in Type 2 Diabetes--an 8-year prospective cohort analysis of 1297 patients.
20456754 2010 Novel mutations in leukotriene C4 synthase and risk of cardiovascular disease based on genotypes from 50,000 individuals.
20395963 2010 Replication of genetic association studies in asthma and related phenotypes.
20128419 2009 5-Lipoxygenase pathway gene polymorphisms: lack of association with asthma in a Spanish population.
19956635 2009 Fulfilling the promise of personalized medicine? Systematic review and field synopsis of pharmacogenetic studies.
19862937 2009 The A-444C polymorphism in the leukotriene C4 synthase gene is associated with aspirin-induced urticaria.
19703064 2009 Impact of pharmacokinetics and pharmacogenetics on the efficacy of pranlukast in Japanese asthmatics.
19559392 2009 A candidate gene association study of 77 polymorphisms in migraine.
19524426 2009 Leukotriene pathway polymorphisms are associated with altered cysteinyl leukotriene production in children with acute asthma.
19479237 2009 Phenotype-genotype interactions on renal function in type 2 diabetes: an analysis using structural equation modelling.
19450127 2009 Asthma pharmacogenetic study using finite mixture models to handle drug-response heterogeneity.
19280718 2009 Leukotriene C4 synthase and ischemic cardiovascular disease and obstructive pulmonary disease in 13,000 individuals.
19263529 2009 Genetic risk factors in recurrent venous thromboembolism: A multilocus, population-based, prospective approach.
19247692 2009 Analyses of associations with asthma in four asthma population samples from Canada and Australia.
19233132 2009 Distinct parts of leukotriene C(4) synthase interact with 5-lipoxygenase and 5-lipoxygenase activating protein.
19223558 2009 Polymorphic variation in NFKB1 and other aspirin-related genes and risk of Hodgkin lymphoma.
19214143 2009 5-lipoxygenase pharmacogenetics in asthma: overlap with Cys-leukotriene receptor antagonist loci.
19131662 2009 A meta-analysis of candidate gene polymorphisms and ischemic stroke in 6 study populations: association of lymphotoxin-alpha in nonhypertensive patients.
19131661 2009 Genetic variation in the leukotriene pathway and carotid intima-media thickness: a 2-stage replication study.
19080797 Analysis of 927T > C CYSLTR1 and -444A > C LTC4S polymorphisms in children with asthma.
19080532 2008 [The relevance of leukotriene C(4) synthase gene A (-444) C polymorphism to clinical responsiveness to montelukast in patients with asthma].
19028820 2009 Polymorphisms in inflammatory genes and the risk of ischemic stroke and transient ischemic attack: results of a multilocus genotyping assay.
18974840 2008 Identification of novel single nucleotide polymorphisms in inflammatory genes as risk factors associated with trachomatous trichiasis.
18366797 2008 Influence of leukotriene gene polymorphisms on chronic rhinosinusitis.
18323512 2008 Genetic variation in members of the leukotriene biosynthesis pathway confer an increased risk of ischemic stroke: a replication study in two independent populations.
18276912 2008 Promotor polymorphisms in leukotriene C4 synthase and risk of ischemic cerebrovascular disease.
17924829 2007 CysLTR1 promoter polymorphism and requirement for leukotriene receptor antagonist in aspirin-intolerant asthma patients.
17883728 2007 Responsiveness to montelukast is associated with bronchial hyperresponsiveness and total immunoglobulin E but not polymorphisms in the leukotriene C4 synthase and cysteinyl leukotriene receptor 1 genes in Korean children with exercise-induced asthma (EIA).
17632548 2007 Crystal structure of a human membrane protein involved in cysteinyl leukotriene biosynthesis.
17632546 2007 Structural basis for synthesis of inflammatory mediators by human leukotriene C4 synthase.
17483957 2007 Microsomal glutathione S-transferase gene polymorphisms and colorectal cancer risk in a Han Chinese population.
17460547 2007 Pharmacogenetics of the 5-lipoxygenase biosynthetic pathway and variable clinical response to montelukast.
17291864 2007 The A-444C polymorphism of leukotriene C4 synthase gene is associated with IgE antibodies to Dermatophagoides pteronyssinus in a Colombian population.
17153879 2006 Analysis of 927T> C CYSLTRI and -444A > C LTC4S polymorphisms in patients with asthma.
17110605 2007 Association between a leukotriene C4 synthase gene promoter polymorphism and coronary artery calcium in young women: the Muscatine Study.
17063752 Expression of leukotriene C4 synthase and plasminogen activator inhibitor 1 gene promoter polymorphisms in sinusitis.
16730545 2006 Leukotriene C4 synthase A-444C gene polymorphism in patients with allergic rhinitis.
16675353 2006 The leukotriene C4 synthase (A-444C) promoter polymorphism is associated with the severity of exercise-induced asthma in Korean children.
16340173 2006 Lack of an association between a newly identified promoter polymorphism (-1702G > A) of the leukotriene C4 synthase gene and aspirin-intolerant asthma in a Korean population.
16293801 2006 Influence of leukotriene pathway polymorphisms on response to montelukast in asthma.
16211251 2005 A novel single-nucleotide substitution, Glu 4 Lys, in the leukotriene C4 synthase gene associated with allergic diseases.
16024972 Association of IL-13, RANTES, and leukotriene C4 synthase gene promoter polymorphisms with asthma and/or atopy in African Americans.
15530365 2004 Human leukotriene C(4) synthase at 4.5 A resolution in projection.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15131571 2004 Characterization of two polymorphisms in the leukotriene C4 synthase gene in an Australian population of subjects with mild, moderate, and severe asthma.
14749922 2004 Leukotriene-related gene polymorphisms in ASA-intolerant asthma: an association with a haplotype of 5-lipoxygenase.
14520724 2003 Effect of montelukast on time-course of exhaled nitric oxide in asthma: influence of LTC4 synthase A(-444)C polymorphism.
12968987 2003 Leukotriene C4 synthase polymorphisms and responsiveness to leukotriene antagonists in asthma.
12816731 2003 Bronchial mast cells are the dominating LTC4S-expressing cells in aspirin-tolerant asthma.
12728163 2003 Allelic association and functional studies of promoter polymorphism in the leukotriene C4 synthase gene (LTC4S) in asthma.
12664565 2002 Regulation of leukotriene C4 synthase gene expression by SP1 and SP3 in mononuclear phagocytes.
12591277 2003 Inverse relationship between myeloid maturation and leukotriene C4 synthase expression in normal and leukemic myelopoiesis-consistent overexpression of the enzyme in myeloid cells from patients with chronic myeloid leukemia.
12589355 2003 Cysteinyl leukotriene expression in chronic hyperplastic sinusitis-nasal polyposis: importance to eosinophilia and asthma.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12360108 2002 Leukotriene C4 synthase gene A(-444)C polymorphism and clinical response to a CYS-LT(1) antagonist, pranlukast, in Japanese patients with moderate asthma.
12023288 2002 Membrane localization and topology of leukotriene C4 synthase.
11770699 2001 LTC4-synthase A-444C polymorphism: lack of association with NSAID-induced isolated periorbital angioedema in a Spanish population.
11034337 2000 Colocalization of leukotriene C synthase and microsomal glutathione S-transferase elucidated by indirect immunofluorescence analysis.
10970815 2000 The leukotriene C(4) synthase gene and asthma.
10896305 2000 Defects in the synthesis of cysteinyl leukotrienes: a new group of inborn errors of metabolism.
10673221 2000 Membrane-associated proteins in eicosanoid and glutathione metabolism (MAPEG). A widespread protein superfamily.
10591082 The biochemical, molecular, and genomic aspects of leukotriene C4 synthase.
10436863 LTC4 synthase. Enzymology, biochemistry, and molecular characterization.
9820300 1998 Leukotriene C4-synthesis deficiency: a new inborn error of metabolism linked to a fatal developmental syndrome.
9435249 1998 5-Lipoxygenase expression in Langerhans cells of normal human epidermis.
9113110 1997 Pharmacological modulation of human platelet leukotriene C4-synthase.
9092565 1997 Production of leukotriene C4 in different human tissues is attributable to distinct membrane bound biosynthetic enzymes.
8898379 1996 Molecular cloning of the human leukotriene C4 synthase gene and assignment to chromosome 5q35.
8706658 1996 Molecular cloning, expression and characterization of mouse leukotriene C4 synthase.
8626689 1996 Molecular cloning of the gene for human leukotriene C4 synthase. Organization, nucleotide sequence, and chromosomal localization to 5q35.
8446623 1993 Purification to homogeneity and the N-terminal sequence of human leukotriene C4 synthase: a homodimeric glutathione S-transferase composed of 18-kDa subunits.
8052639 1994 Expression cloning of a cDNA for human leukotriene C4 synthase, an integral membrane protein conjugating reduced glutathione to leukotriene A4.
7937884 1994 Molecular cloning and expression of human leukotriene-C4 synthase.
7766706 1995 Two step purification of human and murine leukotriene C4 synthase.
7663172 1995 Protein-protein interaction affinity chromatography of leukotriene C4 synthase.
7599836 1995 Purification of human lung leukotriene C4 synthase and preparation of a polyclonal antibody.
1517222 1992 Human leukotriene C4 synthase expression in dimethyl sulfoxide-differentiated U937 cells.
1454853 1992 Purification of human leukotriene C4 synthase.