Property Summary

NCBI Gene PubMed Count 39
PubMed Score 39.09
PubTator Score 25.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (16)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.200 5.5e-05
breast carcinoma -1.400 1.0e-05
ductal carcinoma in situ -1.700 2.6e-04
fibroadenoma -1.100 1.4e-02
inflammatory breast cancer -1.200 2.3e-02
interstitial cystitis -1.200 4.0e-02
intraductal papillary-mucinous adenoma (... -1.200 5.3e-04
intraductal papillary-mucinous neoplasm ... -1.100 1.0e-02
invasive ductal carcinoma -1.294 4.0e-03
lung adenocarcinoma -1.900 2.7e-11
lung carcinoma -1.500 1.6e-14
non-small cell lung cancer -1.581 2.5e-18
ovarian cancer -2.200 7.1e-11
primary pancreatic ductal adenocarcinoma 1.030 4.6e-03
psoriasis -1.700 1.3e-10
sonic hedgehog group medulloblastoma 1.500 2.3e-04

Gene RIF (28)

AA Sequence

MPRPGTSGRRPLLLVLLLPLFAAATSAASPSPSPSQVVEVPGVPSRPASVAVCRCCPGQTSRRSRCIRAF      1 - 70
CRVRSCQPKKCAGPQRCLNPVPAVPSPSPSVRKRQVSLNWQPLTLQEARALLKRRRPRGPGGRGLLRRRP     71 - 140
PQRAPAGKAPVLCPLICHNGGVCVKPDRCLCPPDFAGKFCQLHSSGARPPAPAVPGLTRSVYTMPLANHR    141 - 210
DDEHGVASMVSVHVEHPQEASVVVHQVERVSGPWEEADAEAVARAEAAARAEAAAPYTVLAQSAPREDGY    211 - 280
SDASGFGYCFRELRGGECASPLPGLRTQEVCCRGAGLAWGVHDCQLCSERLGNSERVSAPDGPCPTGFER    281 - 350
VNGSCEDVDECATGGRCQHGECANTRGGYTCVCPDGFLLDSSRSSCISQHVISEAKGPCFRVLRDGGCSL    351 - 420
PILRNITKQICCCSRVGKAWGRGCQLCPPFGSEGFREICPAGPGYHYSASDLRYNTRPLGQEPPRVSLSQ    421 - 490
PRTLPATSRPSAGFLPTHRLEPRPEPRPDPRPGPELPLPSIPAWTGPEIPESGPSSGMCQRNPQVCGPGR    491 - 560
CISRPSGYTCACDSGFRLSPQGTRCIDVDECRRVPPPCAPGRCENSPGSFRCVCGPGFRAGPRAAECLDV    561 - 630
DECHRVPPPCDLGRCENTPGSFLCVCPAGYQAAPHGASCQDVDECTQSPGLCGRGACKNLPGSFRCVCPA    631 - 700
GFRGSACEEDVDECAQEPPPCGPGRCDNTAGSFHCACPAGFRSRGPGAPCQDVDECARSPPPCTYGRCEN    701 - 770
TEGSFQCVCPMGFQPNTAGSECEDVDECENHLACPGQECVNSPGSFQCRTCPSGHHLHRGRCTDVDECSS    771 - 840
GAPPCGPHGHCTNTEGSFRCSCAPGYRAPSGRPGPCADVNECLEGDFCFPHGECLNTDGSFACTCAPGYR    841 - 910
PGPRGASCLDVDECSEEDLCQSGICTNTDGSFECICPPGHRAGPDLASCLDVDECRERGPALCGSQRCEN    911 - 980
SPGSYRCVRDCDPGYHAGPEGTCDDVDECQEYGPEICGAQRCENTPGSYRCTPACDPGYQPTPGGGCQDV    981 - 1050
DECRNRSFCGAHAVCQNLPGSFQCLCDQGYEGARDGRHCVDVNECETLQGVCGAALCENVEGSFLCVCPN   1051 - 1120
SPEEFDPMTGRCVPPRTSAGTFPGSQPQAPASPVLPARPPPPPLPRRPSTPRQGPVGSGRRECYFDTAAP   1121 - 1190
DACDNILARNVTWQECCCTVGEGWGSGCRIQQCPGTETAEYQSLCPHGRGYLAPSGDLSLRRDVDECQLF   1191 - 1260
RDQVCKSGVCVNTAPGYSCYCSNGYYYHTQRLECIDNDECADEEPACEGGRCVNTVGSYHCTCEPPLVLD   1261 - 1330
GSQRRCVSNESQSLDDNLGVCWQEVGADLVCSHPRLDRQATYTECCCLYGEAWGMDCALCPAQDSDDFEA   1331 - 1400
LCNVLRPPAYSPPRPGGFGLPYEYGPDLGPPYQGLPYGPELYPPPALPYDPYPPPPGPFARREAPYGAPR   1401 - 1470
FDMPDFEDDGGPYGESEAPAPPGPGTRWPYRSRDTRRSFPEPEEPPEGGSYAGSLAEPYEELEAEECGIL   1471 - 1540
DGCTNGRCVRVPEGFTCRCFDGYRLDMTRMACVDINECDEAEAASPLCVNARCLNTDGSFRCICRPGFAP   1541 - 1610
THQPHHCAPARPRA                                                           1611 - 1624
//

Text Mined References (41)

PMID Year Title