Property Summary

NCBI Gene PubMed Count 73
PubMed Score 115.03
PubTator Score 246.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.401 2.0e-03
malignant mesothelioma -1.600 5.5e-07
osteosarcoma -1.772 2.5e-05
astrocytoma 1.300 8.4e-03
tuberculosis 1.600 8.0e-07
non-small cell lung cancer -1.266 3.8e-16
lung carcinoma -1.400 9.2e-15
acute myeloid leukemia -1.400 2.7e-02
ovarian cancer -2.900 4.5e-09

 MGI Phenotype (1)

Protein-protein Interaction (1)

Gene RIF (36)

PMID Text
25799317 LTA4H promoter region SNP was associated with susceptibility to bacteriologically confirmed bacterial meningitis but did not influence clinical presentation, disease severity or survival following dexamethasone treatment.
25721704 Report no association between LTA4H SNPs and atherosclerotic plaque phenotypes.
24573245 The best proteinogenic amino acid recognized by LTA4H is arginine.
23828562 The results of our study failed to confirm whether the selected variants in LTA4H gene within the LT metabolism pathway contribute to platelet reactivity in a diabetic population treated with ASA.
23573270 The LTA4H A-9188>G polymorphism has a strong association with severe asthma in children.
23504711 Data indicate that 13S,14S-epoxy-docosahexaenoic acid (DHA) inhibits leukotriene B4 (LTB4) biosynthesis by leukotriene A4 hydrolase (LTA4H).
23153620 We identified a novel leukotriene haplotype that appears to be protective toward subclinical atherosclerosis. This association is modified by dietary intake of polyunsaturated fatty acids
23079278 genetic association studies in population of Han Chinese in Eastern China: Using a recessive genetic model, an SNP in LTA4H (rs6538697) is associated with increased risk of ischemic stroke.
22848428 Structural origins for the loss of catalytic activities of bifunctional human LTA4H revealed through molecular dynamics simulations.
22206291 It was found modest association with LTA4H rs1978331C (intron 11) with increased FEV1 (p = 0.029) and with increased FEV1/FVC ratio (p = 0.020).
21112816 common polymorphisms in the LTA4H gene do not play any major role in susceptibility to clinical pulmonary tuberculosis
20810156 LTA4H and ALOX5AP gene polymorphisms modify the augmentation of bronchodilator responsiveness by leukotriene modifiers in Puerto Ricans but not Mexicans with asthma.
20810156 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20432426 Several point mutants of LTA4H with altered substrate specificities were designed.
20237496 Observational study of gene-disease association. (HuGE Navigator)
20211140 In humans, protection from both tuberculosis and multibacillary leprosy is associated with heterozygosity for LTA4H polymorphisms that have previously been correlated with differential LTB(4) production.
20211140 Observational study of gene-disease association. (HuGE Navigator)
20067482 Our results support the role of LTA4H and ALOX5AP variants as risk factors for asthma in Latino populations.
20067482 Observational study of gene-disease association. (HuGE Navigator)
19919819 The 5-lipoxygenase-leukotriene A4 pathway might play roles in the proliferation of human glioma cells.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19622707 Observational study of gene-disease association. (HuGE Navigator)
19214143 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19131661 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19130089 Observational study of gene-disease association. (HuGE Navigator)
19056482 Observational study of gene-disease association. (HuGE Navigator)
18599387 Analysis of the thermodynamic parameters of irreversible thermal unfolding suggests that entropy-driven factors are responsible for the fast unfolding rate of the cold-adapted aminopeptidase.
18547289 leukotriene A4 hydrolase These data provide evidence for the role of SNPs spanning the ALOX5AP and LTA4H genes in asthma and atopy susceptibility
18547289 Observational study of gene-disease association. (HuGE Navigator)
18323512 Observational study of gene-disease association. (HuGE Navigator)
18318662 Observational study of gene-disease association. (HuGE Navigator)
16698924 5-lipoxygenase and leukotriene A4 hydrolase expression in atherosclerotic lesions correlates with symptoms of plaque instability
16293801 Observational study of gene-disease association. (HuGE Navigator)
16282974 Observational study of gene-disease association. (HuGE Navigator)
15886380 Observational study and clinical trial of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)

AA Sequence

MPEIVDTCSLASPASVCRTKHLHLRCSVDFTRRTLTGTAALTVQSQEDNLRSLVLDTKDLTIEKVVINGQ      1 - 70
EVKYALGERQSYKGSPMEISLPIALSKNQEIVIEISFETSPKSSALQWLTPEQTSGKEHPYLFSQCQAIH     71 - 140
CRAILPCQDTPSVKLTYTAEVSVPKELVALMSAIRDGETPDPEDPSRKIYKFIQKVPIPCYLIALVVGAL    141 - 210
ESRQIGPRTLVWSEKEQVEKSAYEFSETESMLKIAEDLGGPYVWGQYDLLVLPPSFPYGGMENPCLTFVT    211 - 280
PTLLAGDKSLSNVIAHEISHSWTGNLVTNKTWDHFWLNEGHTVYLERHICGRLFGEKFRHFNALGGWGEL    281 - 350
QNSVKTFGETHPFTKLVVDLTDIDPDVAYSSVPYEKGFALLFYLEQLLGGPEIFLGFLKAYVEKFSYKSI    351 - 420
TTDDWKDFLYSYFKDKVDVLNQVDWNAWLYSPGLPPIKPNYDMTLTNACIALSQRWITAKEDDLNSFNAT    421 - 490
DLKDLSSHQLNEFLAQTLQRAPLPLGHIKRMQEVYNFNAINNSEIRFRWLRLCIQSKWEDAIPLALKMAT    491 - 560
EQGRMKFTRPLFKDLAAFDKSHDQAVRTYQEHKASMHPVTAMLVGKDLKVD                       561 - 611
//

Text Mined References (85)

PMID Year Title
26208604 2015 A Potential Role for Acrolein in Neutrophil-Mediated Chronic Inflammation.
26151090 2015 A Randomized, Placebo-controlled Trial of Roflumilast. Effect on Proline-Glycine-Proline and Neutrophilic Inflammation in Chronic Obstructive Pulmonary Disease.
25799317 2015 LTA4H genotype is associated with susceptibility to bacterial meningitis but is not a critical determinant of outcome.
25721704 2015 Variants in ALOX5, ALOX5AP and LTA4H are not associated with atherosclerotic plaque phenotypes: the Athero-Express Genomics Study.
25625859 2015 PENG: a neural gas-based approach for pharmacophore elucidation. method design, validation, and virtual screening for novel ligands of LTA4H.
25257262 2014 Relationship between human LTA4H polymorphisms and extra-pulmonary tuberculosis in an ethnic Han Chinese population in Eastern China.
25072959 2014 The arachidonic acid-LTB4-BLT2 pathway enhances human B-CLL aggressiveness.
24874071 2014 An aberrant leukotriene A4 hydrolase-proline-glycine-proline pathway in the pathogenesis of chronic obstructive pulmonary disease.
24591641 2014 Binding of Pro-Gly-Pro at the active site of leukotriene A4 hydrolase/aminopeptidase and development of an epoxide hydrolase selective inhibitor.
24573245 2014 A remarkable activity of human leukotriene A4 hydrolase (LTA4H) toward unnatural amino acids.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23828562 2013 Lack of effect of common single nucleotide polymorphisms in leukotriene pathway genes on platelet reactivity in patients with diabetes.
23573270 2013 Can certain genotypes predispose to poor asthma control in children? A pharmacogenetic study of 9 candidate genes in children with difficult asthma.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23504711 2013 The novel 13S,14S-epoxy-maresin is converted by human macrophages to maresin 1 (MaR1), inhibits leukotriene A4 hydrolase (LTA4H), and shifts macrophage phenotype.
23153620 2013 Leukotriene A4 hydrolase haplotype, diet and atherosclerosis: a twin study.
23079278 2012 Genetic variation in members of the leukotrienes biosynthesis pathway confers risk of ischemic stroke in Eastern Han Chinese.
22848428 2012 Structural origins for the loss of catalytic activities of bifunctional human LTA4H revealed through molecular dynamics simulations.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22206291 2011 The role of ALOX5AP, LTA4H and LTB4R polymorphisms in determining baseline lung function and COPD susceptibility in UK smokers.
21269460 2011 Initial characterization of the human central proteome.
21112816 2011 Association analysis of the LTA4H gene polymorphisms and pulmonary tuberculosis in 9115 subjects.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20966902 2011 Genome-wide association study of anthropometric traits and evidence of interactions with age and study year in Filipino women.
20810156 2010 ALOX5AP and LTA4H polymorphisms modify augmentation of bronchodilator responsiveness by leukotriene modifiers in Latinos.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20432426 2010 Modulating the substrate specificity of LTA4H aminopeptidase by using chemical compounds and small-molecule-guided mutagenesis.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20211140 2010 The lta4h locus modulates susceptibility to mycobacterial infection in zebrafish and humans.
20067482 2010 The role of LTA4H and ALOX5AP genes in the risk for asthma in Latinos.
19919819 5-lipoxygenase pathway promotes cell proliferation in human glioma cell lines.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19622707 2009 Sex-specific association of depression and a haplotype in leukotriene A4 hydrolase gene.
19618939 2009 Discovery of leukotriene A4 hydrolase inhibitors using metabolomics biased fragment crystallography.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19214143 2009 5-lipoxygenase pharmacogenetics in asthma: overlap with Cys-leukotriene receptor antagonist loci.
19131661 2009 Genetic variation in the leukotriene pathway and carotid intima-media thickness: a 2-stage replication study.
19130089 2009 Genetic effects in the leukotriene biosynthesis pathway and association with atherosclerosis.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19056482 2009 Association of a polymorphism of the apolipoprotein E gene with chronic kidney disease in Japanese individuals with metabolic syndrome.
18804029 2008 Structure-based dissection of the active site chemistry of leukotriene A4 hydrolase: implications for M1 aminopeptidases and inhibitor design.
18599387 2008 Cold adaptation of enzymes: structural, kinetic and microcalorimetric characterizations of an aminopeptidase from the Arctic psychrophile Colwellia psychrerythraea and of human leukotriene A(4) hydrolase.
18547289 2008 The role of LTA4H and ALOX5AP polymorphism in asthma and allergy susceptibility.
18323512 2008 Genetic variation in members of the leukotriene biosynthesis pathway confer an increased risk of ischemic stroke: a replication study in two independent populations.
18318662 2008 Genetic variation in the arachidonate 5-lipoxygenase-activating protein (ALOX5AP) is associated with myocardial infarction in the German population.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16698924 2006 Expression of 5-lipoxygenase and leukotriene A4 hydrolase in human atherosclerotic lesions correlates with symptoms of plaque instability.
16541075 2006 The finished DNA sequence of human chromosome 12.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16293801 2006 Influence of leukotriene pathway polymorphisms on response to montelukast in asthma.
16282974 2006 A variant of the gene encoding leukotriene A4 hydrolase confers ethnicity-specific risk of myocardial infarction.
15886380 2005 Effects of a 5-lipoxygenase-activating protein inhibitor on biomarkers associated with risk of myocardial infarction: a randomized trial.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15078870 2004 Leukotriene A4 hydrolase: identification of a common carboxylate recognition site for the epoxide hydrolase and aminopeptidase substrates.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12207002 2002 Crystal structures of leukotriene A4 hydrolase in complex with captopril and two competitive tight-binding inhibitors.
11917124 2002 Leukotriene A4 hydrolase: selective abrogation of leukotriene B4 formation by mutation of aspartic acid 375.
11675384 2002 Leukotriene A4 hydrolase/aminopeptidase. Glutamate 271 is a catalytic residue with specific roles in two distinct enzyme mechanisms.
11451962 2001 Co-localization of leukotriene a4 hydrolase with 5-lipoxygenase in nuclei of alveolar macrophages and rat basophilic leukemia cells but not neutrophils.
11175901 2001 Crystal structure of human leukotriene A(4) hydrolase, a bifunctional enzyme in inflammation.
11154734 2000 Epoxide hydrolases: biochemistry and molecular biology.
10887124 2000 New induction of leukotriene A(4) hydrolase by interleukin-4 and interleukin-13 in human polymorphonuclear leukocytes.
9733439 1998 Human large luteal cells in the menstrual cycle and early pregnancy express leukotriene A4 hydrolase.
9578147 1998 Inhibitory effect of amphotericin B on leukotriene B4 synthesis in human neutrophils in vitro.
9395533 1997 Regulation of leukotriene A4 hydrolase activity in endothelial cells by phosphorylation.
8615763 1996 The human leukotriene A4 hydrolase gene is expressed in two alternatively spliced mRNA forms.
7843421 1995 Purification and characterization of leukotriene A4 hydrolase from human epidermis.
7667299 1995 Leukotriene A4 hydrolase: mapping of a henicosapeptide involved in mechanism-based inactivation.
7628486 1995 Cloning and characterization of the human leukotriene A4 hydrolase gene.
6490615 1984 Leukotriene A4 hydrolase in human leukocytes. Purification and properties.
3654641 1987 Molecular cloning of a cDNA coding for human leukotriene A4 hydrolase. Complete primary structure of an enzyme involved in eicosanoid synthesis.
3038871 1987 Leukotriene A4 hydrolase in the human lung. Inactivation of the enzyme with leukotriene A4 isomers.
2821541 1987 Molecular cloning and amino acid sequence of leukotriene A4 hydrolase.
2244921 1990 Leukotriene A4 hydrolase: a zinc metalloenzyme.
2233358 1990 Cloning of leukotriene A4 hydrolase cDNA.
1975494 1990 Molecular evolution and zinc ion binding motif of leukotriene A4 hydrolase.
1897988 1991 Leukotriene A4 hydrolase in the human B-lymphocytic cell line Raji: indications of catalytically divergent forms of the enzyme.
1881903 1991 Leukotriene A4 hydrolase: determination of the three zinc-binding ligands by site-directed mutagenesis and zinc analysis.
1516710 1992 Leukotriene A4 hydrolase, a bifunctional enzyme. Distinction of leukotriene A4 hydrolase and aminopeptidase activities by site-directed mutagenesis at Glu-297.
1357660 1992 Leukotriene A4 hydrolase: abrogation of the peptidase activity by mutation of glutamic acid-296.