Property Summary

Ligand Count 383
NCBI Gene PubMed Count 77
PubMed Score 125.35
PubTator Score 246.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
acute myeloid leukemia -1.400 2.7e-02
astrocytoma 1.300 8.4e-03
lung carcinoma -1.400 9.2e-15
malignant mesothelioma -1.600 5.5e-07
non-small cell lung cancer -1.266 3.8e-16
osteosarcoma -1.772 2.5e-05
ovarian cancer -2.900 4.5e-09
tuberculosis 1.600 8.0e-07
Waldenstrons macroglobulinemia 1.401 2.0e-03

 MGI Phenotype (1)

PDB (58)

Gene RIF (39)

AA Sequence

MPEIVDTCSLASPASVCRTKHLHLRCSVDFTRRTLTGTAALTVQSQEDNLRSLVLDTKDLTIEKVVINGQ      1 - 70
EVKYALGERQSYKGSPMEISLPIALSKNQEIVIEISFETSPKSSALQWLTPEQTSGKEHPYLFSQCQAIH     71 - 140
CRAILPCQDTPSVKLTYTAEVSVPKELVALMSAIRDGETPDPEDPSRKIYKFIQKVPIPCYLIALVVGAL    141 - 210
ESRQIGPRTLVWSEKEQVEKSAYEFSETESMLKIAEDLGGPYVWGQYDLLVLPPSFPYGGMENPCLTFVT    211 - 280
PTLLAGDKSLSNVIAHEISHSWTGNLVTNKTWDHFWLNEGHTVYLERHICGRLFGEKFRHFNALGGWGEL    281 - 350
QNSVKTFGETHPFTKLVVDLTDIDPDVAYSSVPYEKGFALLFYLEQLLGGPEIFLGFLKAYVEKFSYKSI    351 - 420
TTDDWKDFLYSYFKDKVDVLNQVDWNAWLYSPGLPPIKPNYDMTLTNACIALSQRWITAKEDDLNSFNAT    421 - 490
DLKDLSSHQLNEFLAQTLQRAPLPLGHIKRMQEVYNFNAINNSEIRFRWLRLCIQSKWEDAIPLALKMAT    491 - 560
EQGRMKFTRPLFKDLAAFDKSHDQAVRTYQEHKASMHPVTAMLVGKDLKVD                       561 - 611
//

Text Mined References (89)

PMID Year Title