Property Summary

NCBI Gene PubMed Count 38
PubMed Score 0.00
PubTator Score 37.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
psoriasis -1.100 1.2e-02
osteosarcoma -3.004 5.7e-04
chronic lymphosyte leukemia -1.900 3.6e-12
glioblastoma 1.800 8.7e-03
medulloblastoma, large-cell -1.200 5.7e-04
adrenocortical carcinoma -1.049 1.7e-02
tuberculosis and treatment for 3 months 1.700 2.5e-06
primary pancreatic ductal adenocarcinoma 1.202 5.9e-03
non-small cell lung cancer -2.058 1.3e-19
lung cancer -2.200 5.4e-06
interstitial cystitis 1.600 1.7e-03
group 4 medulloblastoma -1.100 7.2e-04
pilocytic astrocytoma 1.600 4.4e-07
subependymal giant cell astrocytoma 1.618 2.4e-02
invasive ductal carcinoma 1.086 1.7e-03
lung adenocarcinoma -1.192 1.1e-05
lung carcinoma -1.800 4.3e-23
spina bifida 1.240 5.8e-03
ulcerative colitis 1.500 2.5e-04
ovarian cancer -1.300 5.3e-06

Gene RIF (24)

PMID Text
27384923 Increased expression of LST1 in GC-responders before therapy warrants further investigation into their role as potential predictors for the response to GC, and in the inflammatory process of rheumatoid arthritis.
24816991 Data indicate that the MHC class III gene LST1 5' untranslated regions (5'-UTR) contains several upstream open reading frames (uORFs).
24803336 Psoriasis was associated with promoter variant, rs9267502 of LST1.Promoter activity was examined and it was larger than that of the other genetic variants, most probably due to changes in binding affinity to transcription factors.
24682411 This is the first report demonstrating regulated LST1 expression in human intestinal epithelial and microvascular endothelial cells and in inflamed colonic tissue from IBD patients.
23239025 induces the formation of functional nanotubes
22589543 LST1 is expressed specifically in leukocytes of the myeloid lineage, where it localizes to the tetraspanin-enriched microdomains andit binds SHP-1 and SHP-2 phosphatases.
20854863 Observational study of gene-disease association. (HuGE Navigator)
20689807 Observational study of gene-disease association. (HuGE Navigator)
20668555 Study found association between extended LTA, TNF, LST1 and HLA gene haplotypes and rubella vaccine-induced immunity.
20668555 Observational study of gene-disease association. (HuGE Navigator)
20663564 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20173083 Observational study of genotype prevalence. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19851445 Observational study of gene-disease association. (HuGE Navigator)
19773279 Observational study of gene-disease association. (HuGE Navigator)
19663701 LST1 protein expression in human cell lines was found to be tightly regulated, allowing the expression of transmembrane isoforms but suppressing soluble isoforms
19527514 Observational study of gene-disease association. (HuGE Navigator)
19242354 Observational study of gene-disease association. (HuGE Navigator)
19019335 Observational study of gene-disease association. (HuGE Navigator)
18818748 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16362817 The expression of LST1, specifically splice variants encoding soluble isoforms and NCR3, was increased in rheumatoid-arthritis-affected blood and synovium and was associated with more severe inflammation in the synovium.
12646700 Expression of this receptor, inhibited by TGF-beta1, affects NK-mediated killing of dendritic cells
11828009 Human dendritic cells activate resting natural killer (NK) cells and are recognized via the NKp30 receptor by activated NK cells.

AA Sequence

MLSRNDDICIYGGLGLGGLLLLAVVLLSACLCWLHRRVKRLERSWAQGSSEQELHYASLQRLPVPSSEGP      1 - 70
DLRGRDKRGTKEDPRADYACIAENKPT                                                71 - 97
//

Text Mined References (41)

PMID Year Title
27384923 Expression of ERAP2 and LST1 is increased before start of therapy in rheumatoid arthritis patients with good clinical response to glucocorticoids.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24816991 2014 An upstream open reading frame regulates LST1 expression during monocyte differentiation.
24803336 2014 Identification of functional haplotypes in the promoter region of the LST1 gene.
24682411 2014 Regulated expression of leukocyte-specific transcript (LST) 1 in human intestinal inflammation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23239025 2013 LST1 promotes the assembly of a molecular machinery responsible for tunneling nanotube formation.
22589543 2012 LST1/A is a myeloid leukocyte-specific transmembrane adaptor protein recruiting protein tyrosine phosphatases SHP-1 and SHP-2 to the plasma membrane.
21102463 2010 Genome-wide meta-analysis increases to 71 the number of confirmed Crohn's disease susceptibility loci.
20854863 2010 Characterization of tumor necrosis factor-? block haplotypes associated with susceptibility to chronic venous leg ulcers in Caucasian patients.
20689807 2010 Genetic variation and antioxidant response gene expression in the bronchial airway epithelium of smokers at risk for lung cancer.
20668555 2010 Extended LTA, TNF, LST1 and HLA gene haplotypes and their association with rubella vaccine-induced immunity.
20663564 2010 A strong genetic association between the tumor necrosis factor locus and proliferative vitreoretinopathy: the retina 4 project.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20173083 2010 Genetic variation in metabolizing enzyme and transporter genes: comprehensive assessment in 3 major East Asian subpopulations with comparison to Caucasians and Africans.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19851445 2009 High-density SNP screening of the major histocompatibility complex in systemic lupus erythematosus demonstrates strong evidence for independent susceptibility regions.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19663701 2009 Rat monoclonal antibodies specific for LST1 proteins.
19527514 2009 Racial disparity in pathophysiologic pathways of preterm birth based on genetic variants.
19242354 2009 The tumor necrosis factor polymorphism TNF (-308) is associated with susceptibility to meningococcal sepsis, but not with lethality.
19019335 2009 Spontaneous preterm birth in African Americans is associated with infection and inflammatory response gene variants.
18818748 2008 Preterm birth in Caucasians is associated with coagulation and inflammation pathway gene variants.
17192395 2007 Comparative gene expression profiling of in vitro differentiated megakaryocytes and erythroblasts identifies novel activatory and inhibitory platelet membrane proteins.
16362817 2006 LST1 and NCR3 expression in autoimmune inflammation and in response to IFN-gamma, LPS and microbial infection.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14667819 2004 Analysis of a high-throughput yeast two-hybrid system and its use to predict the function of intracellular proteins encoded within the human MHC class III region.
14656967 2003 Analysis of the gene-dense major histocompatibility complex class III region and its comparison to mouse.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12646700 2003 Transforming growth factor beta 1 inhibits expression of NKp30 and NKG2D receptors: consequences for the NK-mediated killing of dendritic cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11828009 2002 Human dendritic cells activate resting natural killer (NK) cells and are recognized via the NKp30 receptor by activated NK cells.
11478849 2001 Functional analysis of B144/LST1: a gene in the tumor necrosis factor cluster that induces formation of long filopodia in eukaryotic cells.
10944527 2000 Characterization of the promoter of human leukocyte-specific transcript 1. A small gene with a complex pattern of alternative transcripts.
10706707 2000 LST1: a gene with extensive alternative splicing and immunomodulatory function.
10668961 1997 Alternative splicing of the LST-1 gene located in the Major Histocompatibility Complex on human chromosome 6.
10562324 1999 Identification and molecular characterization of NKp30, a novel triggering receptor involved in natural cytotoxicity mediated by human natural killer cells.
9367684 1997 Complex expression pattern of the TNF region gene LST1 through differential regulation, initiation, and alternative splicing.
8824804 1996 Genes in a 220-kb region spanning the TNF cluster in human MHC.
7590964 1995 Cloning and genomic characterization of LST1: a new gene in the human TNF region.
1352700 1992 Polymorphism in the human B144 gene in different MHC haplotypes.