Property Summary

NCBI Gene PubMed Count 19
PubMed Score 75.49
PubTator Score 20.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
Multiple myeloma 1.248 3.0e-03
malignant mesothelioma 2.200 5.8e-07
esophageal adenocarcinoma 1.500 4.8e-02
atypical teratoid / rhabdoid tumor 1.700 6.1e-03
tuberculosis -1.400 9.7e-05
non-small cell lung cancer 1.103 1.8e-10
lung cancer 1.200 1.1e-03
pancreatic cancer 1.200 1.5e-03
posterior fossa group A ependymoma 1.100 8.0e-05
lung adenocarcinoma 1.781 1.5e-07
inflammatory breast cancer 1.100 1.2e-02
ductal carcinoma in situ 2.000 1.6e-03
invasive ductal carcinoma 2.500 1.6e-03

Protein-protein Interaction (11)

Gene RIF (5)

PMID Text
25882847 analysis of how Clostridium difficile binary toxin CDT interacts with its host cell receptor, Lipolysis-stimulated Lipoprotein Receptor
23631918 These data show that Clostridium difficile binary toxin CDT induces clustering of the lipolysis-stimulated lipoprotein receptor into lipid rafts.
22252869 findings show that Clostridium spiroforme toxin (CST)enters target cells via the lipolysis-stimulated lipoprotein receptor; findings indicate that CST shares LSR with C. difficile CDT and C. perfringens iota toxin as a host cell surface receptor
21245199 LSR defines tricellular contacts in epithelial cellular sheets by acting as a landmark to recruit tricellulin for tricellular tight junction formation.
17975147 LISCH7 may have a role in progression of human colon cancer

AA Sequence

MQQDGLGVGTRNGSGKGRSVHPSWPWCAPRPLRYFGRDARARRAQTAAMALLAGGLSRGLGSHPAAAGRD      1 - 70
AVVFVWLLLSTWCTAPARAIQVTVSNPYHVVILFQPVTLPCTYQMTSTPTQPIVIWKYKSFCRDRIADAF     71 - 140
SPASVDNQLNAQLAAGNPGYNPYVECQDSVRTVRVVATKQGNAVTLGDYYQGRRITITGNADLTFDQTAW    141 - 210
GDSGVYYCSVVSAQDLQGNNEAYAELIVLGRTSGVAELLPGFQAGPIEDWLFVVVVCLAAFLIFLLLGIC    211 - 280
WCQCCPHTCCCYVRCPCCPDKCCCPEALYAAGKAATSGVPSIYAPSTYAHLSPAKTPPPPAMIPMGPAYN    281 - 350
GYPGGYPGDVDRSSSAGGQGSYVPLLRDTDSSVASEVRSGYRIQASQQDDSMRVLYYMEKELANFDPSRP    351 - 420
GPPSGRVERAMSEVTSLHEDDWRSRPSRGPALTPIRDEEWGGHSPRSPRGWDQEPAREQAGGGWRARRPR    421 - 490
ARSVDALDDLTPPSTAESGSRSPTSNGGRSRAYMPPRSRSRDDLYDQDDSRDFPRSRDPHYDDFRSRERP    491 - 560
PADPRSHHHRTRDPRDNGSRSGDLPYDGRLLEEAVRKKGSEERRRPHKEEEEEAYYPPAPPPYSETDSQA    561 - 630
SRERRLKKNLALSRESLVV                                                       631 - 649
//

Text Mined References (27)

PMID Year Title
25882847 2015 Interaction of the Clostridium difficile Binary Toxin CDT and Its Host Cell Receptor, Lipolysis-stimulated Lipoprotein Receptor (LSR).
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23631918 2013 Clostridium difficile binary toxin CDT induces clustering of the lipolysis-stimulated lipoprotein receptor into lipid rafts.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22252869 2012 Identification of the cellular receptor of Clostridium spiroforme toxin.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21245199 2011 LSR defines cell corners for tricellular tight junction formation in epithelial cells.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18318008 2008 Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17975147 2007 Prognostic value of LISCH7 mRNA in plasma and tumor of colon cancer patients.
17693683 2007 Quantitative phosphoproteome profiling of Wnt3a-mediated signaling network: indicating the involvement of ribonucleoside-diphosphate reductase M2 subunit phosphorylation at residue serine 20 in canonical Wnt signal transduction.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16341674 2005 Transcriptome analysis of human gastric cancer.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
16083285 Global phosphoproteome of HT-29 human colon adenocarcinoma cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15324660 2004 Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10224102 1999 Molecular cloning of a lipolysis-stimulated remnant receptor expressed in the liver.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.