Property Summary

NCBI Gene PubMed Count 22
PubMed Score 4.97
PubTator Score 3.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
psoriasis -1.200 1.3e-03
astrocytoma 1.100 1.1e-16
glioblastoma 1.500 1.5e-09
oligodendroglioma 1.200 2.5e-14
osteosarcoma -1.429 1.7e-02
group 3 medulloblastoma 1.800 5.7e-05
atypical teratoid/rhabdoid tumor 1.300 2.6e-07
primitive neuroectodermal tumor 1.200 5.9e-04
adrenocortical carcinoma 1.088 3.2e-04
lung cancer 1.400 5.1e-04
breast carcinoma 1.200 1.5e-02
pediatric high grade glioma 1.400 3.1e-06
ovarian cancer 1.100 7.2e-03
pituitary cancer 1.200 1.3e-06

Gene RIF (1)

PMID Text
22875987 LSm8 controls nuclear accumulation of all LSm2-7 proteins and the number of cytoplasmic processing bodies.

AA Sequence

MTSALENYINRTVAVITSDGRMIVGTLKGFDQTINLILDESHERVFSSSQGVEQVVLGLYIVRGDNVAVI      1 - 70
GEIDEETDSALDLGNIRAEPLNSVAH                                                 71 - 96
//

Text Mined References (26)

PMID Year Title
24709693 2014 Genome-wide data reveal novel genes for methotrexate response in a large cohort of juvenile idiopathic arthritis cases.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22875987 2012 Nuclear LSm8 affects number of cytoplasmic processing bodies via controlling cellular distribution of Like-Sm proteins.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21269460 2011 Initial characterization of the human central proteome.
19660095 2009 A synopsis of eukaryotic Nalpha-terminal acetyltransferases: nomenclature, subunits and substrates.
19398576 2009 Knockdown of human N alpha-terminal acetyltransferase complex C leads to p53-dependent apoptosis and aberrant human Arl8b localization.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16051491 2005 LSm proteins form heptameric rings that bind to RNA via repeating motifs.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231747 2004 A protein interaction framework for human mRNA degradation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14667819 2004 Analysis of a high-throughput yeast two-hybrid system and its use to predict the function of intracellular proteins encoded within the human MHC class III region.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11920408 2002 Autoantibody to hLSm4 and the heptameric LSm complex in anti-Sm sera.
10523320 1999 A doughnut-shaped heteromer of human Sm-like proteins binds to the 3'-end of U6 snRNA, thereby facilitating U4/U6 duplex formation in vitro.
10369684 1999 Sm and Sm-like proteins assemble in two related complexes of deep evolutionary origin.
9847074 1998 Toward a complete human genome sequence.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.