Property Summary

NCBI Gene PubMed Count 25
PubMed Score 139.89
PubTator Score 12.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Rheumatoid Arthritis -1.300 4.7e-03
astrocytic glioma -1.400 1.0e-02
osteosarcoma -1.708 7.9e-07
tuberculosis 1.100 3.3e-08
primary pancreatic ductal adenocarcinoma 1.316 1.2e-02
intraductal papillary-mucinous carcinoma... 1.200 4.9e-04
lung cancer 1.900 1.6e-05
group 3 medulloblastoma 1.300 4.1e-02
lung adenocarcinoma 1.164 6.8e-05
breast carcinoma 1.100 2.2e-12
invasive ductal carcinoma 1.200 7.8e-04
ovarian cancer 2.800 1.6e-05
pancreatic cancer 1.100 3.0e-02
dermatomyositis -1.200 1.8e-02

 MGI Phenotype (1)

Gene RIF (6)

PMID Text
24255165 C-terminal extension of Lsm4 interacts directly with the histone mRNP, contacting both SLBP and 3'hExo.
19240061 Observational study of gene-disease association. (HuGE Navigator)
19088440 LSm4 not only acts in RNA processing, but also as a co-factor in cell volume regulation.
17178857 Gene induces transformed phenotype when overexpressed in a cancer breast cell line.
15905169 Data show that ICln159, a truncated ICln mutant, belongs to the pleckstrin homology (PH) domain family of proteins and interacts with LSm4, a protein involved in splicing and mRNA degradation.
12515382 LSm1-7 proteins colocalize with DCP1,DCP2 and Xrn1 in cytoplasmic foci

AA Sequence

MLPLSLLKTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDKFWRMPECYIRGSTIKYLR      1 - 70
IPDEIIDMVKEEVVAKGRGRGGLQQQKQQKGRGMGGAGRGVFGGRGRGGIPGTGRGQPEKKPGRQAGKQ      71 - 139
//

Text Mined References (28)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24255165 2014 The C-terminal extension of Lsm4 interacts directly with the 3' end of the histone mRNP and is required for efficient histone mRNA degradation.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21269460 2011 Initial characterization of the human central proteome.
20696395 2010 Conserved beta-hairpin recognition by the GYF domains of Smy2 and GIGYF2 in mRNA surveillance and vesicular transport complexes.
20584987 2010 Human Pat1b connects deadenylation with mRNA decapping and controls the assembly of processing bodies.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
19088440 2008 LSm4 associates with the plasma membrane and acts as a co-factor in cell volume regulation.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17178857 2006 Multiple interacting oncogenes on the 8p11-p12 amplicon in human breast cancer.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15905169 2005 ICln159 folds into a pleckstrin homology domain-like structure. Interaction with kinases and the splicing factor LSm4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231747 2004 A protein interaction framework for human mRNA degradation.
12515382 2002 The human LSm1-7 proteins colocalize with the mRNA-degrading enzymes Dcp1/2 and Xrnl in distinct cytoplasmic foci.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11920408 2002 Autoantibody to hLSm4 and the heptameric LSm complex in anti-Sm sera.
10931946 2000 Gene expression profiling in the human hypothalamus-pituitary-adrenal axis and full-length cDNA cloning.
10851237 2000 Specific sequences of the Sm and Sm-like (Lsm) proteins mediate their interaction with the spinal muscular atrophy disease gene product (SMN).
10523320 1999 A doughnut-shaped heteromer of human Sm-like proteins binds to the 3'-end of U6 snRNA, thereby facilitating U4/U6 duplex formation in vitro.
10369684 1999 Sm and Sm-like proteins assemble in two related complexes of deep evolutionary origin.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.