Property Summary

NCBI Gene PubMed Count 30
PubMed Score 21.54
PubTator Score 350.95

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
atypical teratoid/rhabdoid tumor 1095 1.3e-06
group 3 medulloblastoma 2254 2.6e-04
lung cancer 4473 2.7e-04
diabetes mellitus 1663 1.2e-03
Disease Target Count Z-score Confidence
Orchitis 16 3.133 1.6

Expression

  Differential Expression (4)

Disease log2 FC p
group 3 medulloblastoma 1.800 2.6e-04
atypical teratoid/rhabdoid tumor 1.200 1.3e-06
lung cancer 2.100 2.7e-04
diabetes mellitus -1.300 1.2e-03

Gene RIF (6)

PMID Text
26261020 SNRPN is a key player in pancreatic adenocarcinoma cell growth; depletion of SNRPN led to S phase cell cycle arrest and apoptosis
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19851445 Observational study of gene-disease association. (HuGE Navigator)
18095154 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12515382 LSm1-7 proteins colocalize with DCP1,DCP2 and Xrn1 in cytoplasmic foci

AA Sequence

MLFYSFFKSLVGKDVVVELKNDLSICGTLHSVDQYLNIKLTDISVTDPEKYPHMLSVKNCFIRGSVVRYV      1 - 70
QLPADEVDTQLLQDAARKEALQQKQ                                                  71 - 95
//

Text Mined References (33)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26261020 2015 Small nuclear ribonucleoprotein associated polypeptide N accelerates cell proliferation in pancreatic adenocarcinoma.
25416956 2014 A proteome-scale map of the human interactome network.
24056301 2013 The deubiquitylase USP33 discriminates between RALB functions in autophagy and innate immune response.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21269460 2011 Initial characterization of the human central proteome.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19851445 2009 High-density SNP screening of the major histocompatibility complex in systemic lupus erythematosus demonstrates strong evidence for independent susceptibility regions.
18095154 2008 Use of expression data and the CGEMS genome-wide breast cancer association study to identify genes that may modify risk in BRCA1/2 mutation carriers.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15231747 2004 A protein interaction framework for human mRNA degradation.
14667819 2004 Analysis of a high-throughput yeast two-hybrid system and its use to predict the function of intracellular proteins encoded within the human MHC class III region.
14656967 2003 Analysis of the gene-dense major histocompatibility complex class III region and its comparison to mouse.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12515382 2002 The human LSm1-7 proteins colocalize with the mRNA-degrading enzymes Dcp1/2 and Xrnl in distinct cytoplasmic foci.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12226669 2002 Comprehensive proteomic analysis of the human spliceosome.
11991638 2002 Purification and characterization of native spliceosomes suitable for three-dimensional structural analysis.
11920408 2002 Autoantibody to hLSm4 and the heptameric LSm complex in anti-Sm sera.
11275683 2001 Determination of protein-protein interactions of ICIn by the yeast two-hybrid system.
10931946 2000 Gene expression profiling in the human hypothalamus-pituitary-adrenal axis and full-length cDNA cloning.
10851237 2000 Specific sequences of the Sm and Sm-like (Lsm) proteins mediate their interaction with the spinal muscular atrophy disease gene product (SMN).
10523320 1999 A doughnut-shaped heteromer of human Sm-like proteins binds to the 3'-end of U6 snRNA, thereby facilitating U4/U6 duplex formation in vitro.
8428774 1993 Localization of a new gene adjacent to the HSP70 genes in human and mouse MHCs.