Property Summary

NCBI Gene PubMed Count 29
PubMed Score 102.20
PubTator Score 44.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count
Peripheral Neuropathy 303
Disease Target Count P-value
invasive ductal carcinoma 2950 1.7e-02
Disease Target Count Z-score Confidence
Schizophrenia 503 0.0 2.0
Disease Target Count Z-score Confidence
pancreatic cancer 2300 3.177 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
invasive ductal carcinoma 1.100 1.7e-02

 GWAS Trait (1)

Gene RIF (7)

PMID Text
25872476 These results provide evidence that LSm1 binding to the DENV RNA 3' UTR positively regulates DENV RNA replication.
24035562 The results of this study provided further support for previous genetic findings reporting the association of an intronic SNP (rs16887244) in LSM1 and schizophrenia in a Chinese sample
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18218995 Results suggest that LSm-1/CaSm functions as an oncogene in the promotion of cellular transformation and cancer progression.
17001308 LSM1 is a breast cancer oncogene from the 8p11-12 amplicon.
12515382 LSm1-7 proteins colocalize with DCP1,DCP2 and Xrn1 in cytoplasmic foci
11953827 Lsm1 is deeply involved in prostate cancer progression through its down-regulation, independent of any gene mutation.

AA Sequence

MNYMPGTASLIEDIDKKHLVLLRDGRTLIGFLRSIDQFANLVLHQTVERIHVGKKYGDIPRGIFVVRGEN      1 - 70
VVLLGEIDLEKESDTPLQQVSIEEILEEQRVEQQTKLEAEKLKVQALKDRGLSIPRADTLDEY            71 - 133
//

Text Mined References (31)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
25872476 2015 LSm1 binds to the Dengue virus RNA 3' UTR and is a positive regulator of Dengue virus replication.
25416956 2014 A proteome-scale map of the human interactome network.
24035562 2013 Further evidence for the association between the LSM1 gene and schizophrenia.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22037555 2011 Common variants on 8p12 and 1q24.2 confer risk of schizophrenia.
21788678 A sparse regulatory network of copy-number driven gene expression reveals putative breast cancer oncogenes.
20852261 2011 The human Pat1b protein: a novel mRNA deadenylation factor identified by a new immunoprecipitation technique.
20584987 2010 Human Pat1b connects deadenylation with mRNA decapping and controls the assembly of processing bodies.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18559850 2008 Minor spliceosome components are predominantly localized in the nucleus.
18218995 2008 CaSm (LSm-1) overexpression in lung cancer and mesothelioma is required for transformed phenotypes.
18172165 2008 Degradation of histone mRNA requires oligouridylation followed by decapping and simultaneous degradation of the mRNA both 5' to 3' and 3' to 5'.
17178857 2006 Multiple interacting oncogenes on the 8p11-p12 amplicon in human breast cancer.
17001308 2007 Transforming function of the LSM1 oncogene in human breast cancers with the 8p11-12 amplicon.
16756390 2006 Translation repression in human cells by microRNA-induced gene silencing requires RCK/p54.
16699599 2006 Human retroviral host restriction factors APOBEC3G and APOBEC3F localize to mRNA processing bodies.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15231747 2004 A protein interaction framework for human mRNA degradation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14667819 2004 Analysis of a high-throughput yeast two-hybrid system and its use to predict the function of intracellular proteins encoded within the human MHC class III region.
12515382 2002 The human LSm1-7 proteins colocalize with the mRNA-degrading enzymes Dcp1/2 and Xrnl in distinct cytoplasmic foci.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11920408 2002 Autoantibody to hLSm4 and the heptameric LSm complex in anti-Sm sera.
10851237 2000 Specific sequences of the Sm and Sm-like (Lsm) proteins mediate their interaction with the spinal muscular atrophy disease gene product (SMN).
10523320 1999 A doughnut-shaped heteromer of human Sm-like proteins binds to the 3'-end of U6 snRNA, thereby facilitating U4/U6 duplex formation in vitro.
10369684 1999 Sm and Sm-like proteins assemble in two related complexes of deep evolutionary origin.
9230209 1997 CaSm: an Sm-like protein that contributes to the transformed state in cancer cells.