Property Summary

NCBI Gene PubMed Count 12
PubMed Score 14.10
PubTator Score 12.66

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

Gene RIF (8)

AA Sequence

MGTPWRKRKGIAGPGLPDLSCALVLQPRAQVGTMSPAIALAFLPLVVTLLVRYRHYFRLLVRTVLLRSLR      1 - 70
DCLSGLRIEERAFSYVLTHALPGDPGHILTTLDHWSSRCEYLSHMGPVKGQILMRLVEEKAPACVLELGT     71 - 140
YCGYSTLLIARALPPGGRLLTVERDPRTAAVAEKLIRLAGFDEHMVELIVGSSEDVIPCLRTQYQLSRAD    141 - 210
LVLLAHRPRCYLRDLQLLEAHALLPAGATVLADHVLFPGAPRFLQYAKSCGRYRCRLHHTGLPDFPAIKD    211 - 280
GIAQLTYAGPG                                                               281 - 291
//

Text Mined References (16)

PMID Year Title