Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.42
PubTator Score 0.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
ependymoma -1.500 1.7e-11
glioblastoma -1.600 1.5e-04
medulloblastoma -1.400 3.6e-06
atypical teratoid / rhabdoid tumor -1.700 3.0e-08
primitive neuroectodermal tumor -1.500 2.9e-05
adult high grade glioma -1.600 2.2e-04
pilocytic astrocytoma -1.600 1.1e-06
non primary Sjogren syndrome sicca 1.100 1.3e-02

AA Sequence

MLAPGSSPGQRGRLALQWRQVSWITCWIALYAVEALPTCPFSCKCDSRSLEVDCSGLGLTTVPPDVPAAT      1 - 70
RTLLLLNNKLSALPSWAFANLSSLQRLDLSNNFLDRLPRSIFGDLTNLTELQLRNNSIRTLDRDLLRHSP     71 - 140
LLRHLDLSINGLAQLPPGLFDGLLALRSLSLRSNRLQNLDRLTFEPLANLQLLQVGDNPWECDCNLREFK    141 - 210
HWMEWFSYRGGRLDQLACTLPKELRGKDMRMVPMEMFNYCSQLEDENSSAGLDIPGPPCTKASPEPAKPK    211 - 280
PGAEPEPEPSTACPQKQRHRPASVRRAMGTVIIAGVVCGVVCIMMVVAAAYGCIYASLMAKYHRELKKRQ    281 - 350
PLMGDPEGEHEDQKQISSVA                                                      351 - 370
//

Text Mined References (5)

PMID Year Title
23942779 2013 A genome-wide association study of behavioral disinhibition.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.