Property Summary

NCBI Gene PubMed Count 7
PubMed Score 8.30
PubTator Score 3.21

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (13)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -2.600 1.3e-04
colon cancer -1.700 2.8e-02
ependymoma -3.200 1.6e-11
glioblastoma -1.200 4.3e-03
group 4 medulloblastoma -1.500 8.1e-04
invasive ductal carcinoma -1.100 2.6e-03
lung cancer -1.400 4.6e-04
lung carcinoma 1.500 1.2e-17
osteosarcoma -1.282 6.9e-03
ovarian cancer -2.700 4.7e-07
pediatric high grade glioma -2.000 1.9e-04
pituitary cancer 2.300 3.0e-08
psoriasis -1.600 1.3e-03

Gene RIF (2)

AA Sequence

MGLHFKWPLGAPMLAAIYAMSMVLKMLPALGMACPPKCRCEKLLFYCDSQGFHSVPNATDKGSLGLSLRH      1 - 70
NHITELERDQFASFSQLTWLHLDHNQISTVKEDAFQGLYKLKELILSSNKIFYLPNTTFTQLINLQNLDL     71 - 140
SFNQLSSLHPELFYGLRKLQTLHLRSNSLRTIPVRLFWDCRSLEFLDLSTNRLRSLARNGFAGLIKLREL    141 - 210
HLEHNQLTKINFAHFLRLSSLHTLFLQWNKISNLTCGMEWTWGTLEKLDLTGNEIKAIDLTVFETMPNLK    211 - 280
ILLMDNNKLNSLDSKILNSLRSLTTVGLSGNLWECSARICALASWLGSFQGRWEHSILCHSPDHTQGEDI    281 - 350
LDAVHGFQLCWNLSTTVTVMATTYRDPTTEYTKRISSSSYHVGDKEIPTTAGIAVTTEEHFPEPDNAIFT    351 - 420
QRVITGTMALLFSFFFIIFIVFISRKCCPPTLRRIRQCSMVQNHRQLRSQTRLHMSNMSDQGPYNEYEPT    421 - 490
HEGPFIIINGYGQCKCQQLPYKECEV                                                491 - 516
//

Text Mined References (8)

PMID Year Title