Property Summary

NCBI Gene PubMed Count 16
PubMed Score 15.80
PubTator Score 14.90

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (7)

Disease log2 FC p
adult high grade glioma -2.200 9.6e-04
astrocytic glioma -1.300 5.7e-03
atypical teratoid / rhabdoid tumor -2.600 3.2e-05
ependymoma -1.300 2.1e-02
glioblastoma -1.500 2.4e-03
group 3 medulloblastoma -2.800 1.5e-03
medulloblastoma, large-cell -2.800 9.2e-04

Gene RIF (11)

AA Sequence

MDFLLLGLCLYWLLRRPSGVVLCLLGACFQMLPAAPSGCPQLCRCEGRLLYCEALNLTEAPHNLSGLLGL      1 - 70
SLRYNSLSELRAGQFTGLMQLTWLYLDHNHICSVQGDAFQKLRRVKELTLSSNQITQLPNTTFRPMPNLR     71 - 140
SVDLSYNKLQALAPDLFHGLRKLTTLHMRANAIQFVPVRIFQDCRSLKFLDIGYNQLKSLARNSFAGLFK    141 - 210
LTELHLEHNDLVKVNFAHFPRLISLHSLCLRRNKVAIVVSSLDWVWNLEKMDLSGNEIEYMEPHVFETVP    211 - 280
HLQSLQLDSNRLTYIEPRILNSWKSLTSITLAGNLWDCGRNVCALASWLNNFQGRYDGNLQCASPEYAQG    281 - 350
EDVLDAVYAFHLCEDGAEPTSGHLLSAVTNRSDLGPPASSATTLADGGEGQHDGTFEPATVALPGGEHAE    351 - 420
NAVQIHKVVTGTMALIFSFLIVVLVLYVSWKCFPASLRQLRQCFVTQRRKQKQKQTMHQMAAMSAQEYYV    421 - 490
DYKPNHIEGALVIINEYGSCTCHQQPARECEV                                          491 - 522
//

Text Mined References (16)

PMID Year Title