Property Summary

NCBI Gene PubMed Count 29
PubMed Score 15.72
PubTator Score 18.32

Knowledge Summary

Patent (1,117)

TINX Plot

  Disease (4)

Expression

  Differential Expression (8)

Disease log2 FC p
osteosarcoma -3.095 1.8e-08
cystic fibrosis 1.087 4.9e-04
atypical teratoid / rhabdoid tumor -1.700 2.9e-08
glioblastoma -1.300 6.2e-04
group 4 medulloblastoma -1.300 1.9e-03
medulloblastoma, large-cell -1.700 2.5e-04
primitive neuroectodermal tumor -1.200 8.1e-03
lung carcinoma -1.500 3.1e-32

 GWAS Trait (1)

Gene RIF (15)

PMID Text
26192437 LRRK1 regulates mitotic spindle orientation downstream of PLK1 through CDK5RAP2-dependent centrosome maturation.
25413345 We find that LRRK1-mediated phosphorylation of CLIP-170 causes the accumulation of p150(Glued) (also known as DCTN1) a subunit of dynactin, at microtubule plus ends, thereby facilitating the migration of EGFR-containing endosomes.
24947832 LRRK1 carries out distinct functions from LRRK2 by interacting with different cellular proteins.
24241507 LRRK1 mutations may have a role in Parkinson's disease
22988872 The function of LRRK1 and both the physiological and the pathological roles of LRRK2 are only beginning to unfold.
22952686 purified and active LRRK1 and LRRK2 can form dimers in their full-length conformation
22337768 feedback down-regulation of LRRK1 kinase activity by EGFR plays an important role in the appropriate endosomal trafficking of EGFR
18272292 LRRK1 are active in the adult human cortex cerebri, hippocampus and also seen in the young human thymus.
18045479 LRRK1 genes encode low levels of expressed mRNA corresponding to low levels of protein during development.
17394548 mutations in LRRK2 are more prone to form inclusion bodies in transfected cells and are more toxic than equivalent mutations in LRRK1
17324517 Observational study of gene-disease association. (HuGE Navigator)
17324517 Two rare coding variants ss65713826 and ss65713830 were more frequent in patients than controls in norwegain Parkinson's disease.
17225181 Comparison of evolutionary interspecies sequences of LRRK1 and LRRK2 suggests they diverged from a common founder gene implicated in Parkinson disease.
16243488 We report the molecular characterization of human LRRK1 and show for the first time that LRRK1 is a functional protein kinase and a GDP/GTP-binding protein. We propose a model in which LRRK1 cycles between a GTP-bound active and a GDP-bound inactive state
16243488 LRRK1 binds GTP and GDP via its Roc domain and autophosphorylation activity is selectively triggered by GTP. Kinase activity was decreased following introduction of mutations homologous to those of LRRK2 that have been associated with Parkinson's disease.

AA Sequence

MAGMSQRPPSMYWCVGPEESAVCPERAMETLNGAGDTGGKPSTRGGDPAARSRRTEGIRAAYRRGDRGGA      1 - 70
RDLLEEACDQCASQLEKGQLLSIPAAYGDLEMVRYLLSKRLVELPTEPTDDNPAVVAAYFGHTAVVQELL     71 - 140
ESLPGPCSPQRLLNWMLALACQRGHLGVVKLLVLTHGADPESYAVRKNEFPVIVRLPLYAAIKSGNEDIA    141 - 210
IFLLRHGAYFCSYILLDSPDPSKHLLRKYFIEASPLPSSYPGKTALRVKWSHLRLPWVDLDWLIDISCQI    211 - 280
TELDLSANCLATLPSVIPWGLINLRKLNLSDNHLGELPGVQSSDEIICSRLLEIDISSNKLSHLPPGFLH    281 - 350
LSKLQKLTASKNCLEKLFEEENATNWIGLRKLQELDISDNKLTELPALFLHSFKSLNSLNVSRNNLKVFP    351 - 420
DPWACPLKCCKASRNALECLPDKMAVFWKNHLKDVDFSENALKEVPLGLFQLDALMFLRLQGNQLAALPP    421 - 490
QEKWTCRQLKTLDLSRNQLGKNEDGLKTKRIAFFTTRGRQRSGTEAASVLEFPAFLSESLEVLCLNDNHL    491 - 560
DTVPPSVCLLKSLSELYLGNNPGLRELPPELGQLGNLWQLDTEDLTISNVPAEIQKEGPKAMLSYLRAQL    561 - 630
RKAEKCKLMKMIIVGPPRQGKSTLLEILQTGRAPQVVHGEATIRTTKWELQRPAGSRAKVESVEFNVWDI    631 - 700
GGPASMATVNQCFFTDKALYVVVWNLALGEEAVANLQFWLLNIEAKAPNAVVLVVGTHLDLIEAKFRVER    701 - 770
IATLRAYVLALCRSPSGSRATGFPDITFKHLHEISCKSLEGQEGLRQLIFHVTCSMKDVGSTIGCQRLAG    771 - 840
RLIPRSYLSLQEAVLAEQQRRSRDDDVQYLTDRQLEQLVEQTPDNDIKDYEDLQSAISFLIETGTLLHFP    841 - 910
DTSHGLRNLYFLDPIWLSECLQRIFNIKGSRSVAKNGVIRAEDLRMLLVGTGFTQQTEEQYFQFLAKFEI    911 - 980
ALPVANDSYLLPHLLPSKPGLDTHGMRHPTANTIQRVFKMSFVPVGFWQRFIARMLISLAEMDLQLFENK    981 - 1050
KNTKSRNRKVTIYSFTGNQRNRCSTFRVKRNQTIYWQEGLLVTFDGGYLSVESSDVNWKKKKSGGMKIVC   1051 - 1120
QSEVRDFSAMAFITDHVNSLIDQWFPALTATESDGTPLMEQYVPCPVCETAWAQHTDPSEKSEDVQYFDM   1121 - 1190
EDCVLTAIERDFISCPRHPDLPVPLQELVPELFMTDFPARLFLENSKLEHSEDEGSVLGQGGSGTVIYRA   1191 - 1260
RYQGQPVAVKRFHIKKFKNFANVPADTMLRHLRATDAMKNFSEFRQEASMLHALQHPCIVALIGISIHPL   1261 - 1330
CFALELAPLSSLNTVLSENARDSSFIPLGHMLTQKIAYQIASGLAYLHKKNIIFCDLKSDNILVWSLDVK   1331 - 1400
EHINIKLSDYGISRQSFHEGALGVEGTPGYQAPEIRPRIVYDEKVDMFSYGMVLYELLSGQRPALGHHQL   1401 - 1470
QIAKKLSKGIRPVLGQPEEVQFRRLQALMMECWDTKPEKRPLALSVVSQMKDPTFATFMYELCCGKQTAF   1471 - 1540
FSSQGQEYTVVFWDGKEESRNYTVVNTEKGLMEVQRMCCPGMKVSCQLQVQRSLWTATEDQKIYIYTLKG   1541 - 1610
MCPLNTPQQALDTPAVVTCFLAVPVIKKNSYLVLAGLADGLVAVFPVVRGTPKDSCSYLCSHTANRSKFS   1611 - 1680
IADEDARQNPYPVKAMEVVNSGSEVWYSNGPGLLVIDCASLEICRRLEPYMAPSMVTSVVCSSEGRGEEV   1681 - 1750
VWCLDDKANSLVMYHSTTYQLCARYFCGVPSPLRDMFPVRPLDTEPPAASHTANPKVPEGDSIADVSIMY   1751 - 1820
SEELGTQILIHQESLTDYCSMSSYSSSPPRQAARSPSSLPSSPASSSSVPFSTDCEDSDMLHTPGAASDR   1821 - 1890
SEHDLTPMDGETFSQHLQAVKILAVRDLIWVPRRGGDVIVIGLEKDSGAQRGRVIAVLKARELTPHGVLV   1891 - 1960
DAAVVAKDTVVCTFENENTEWCLAVWRGWGAREFDIFYQSYEELGRLEACTRKRR                  1961 - 2015
//

Text Mined References (30)

PMID Year Title
26192437 2015 PLK1-dependent activation of LRRK1 regulates spindle orientation by phosphorylating CDK5RAP2.
25413345 2015 LRRK1-phosphorylated CLIP-170 regulates EGFR trafficking by recruiting p150Glued to microtubule plus ends.
24947832 2014 Differential protein-protein interactions of LRRK1 and LRRK2 indicate roles in distinct cellular signaling pathways.
24510904 2014 Unbiased screen for interactors of leucine-rich repeat kinase 2 supports a common pathway for sporadic and familial Parkinson disease.
24241507 2014 Rare variants in LRRK1 and Parkinson's disease.
23291589 2013 Genome-wide association analyses identify multiple loci associated with central corneal thickness and keratoconus.
22988872 2012 Human leucine-rich repeat kinase 1 and 2: intersecting or unrelated functions?
22952686 2012 Biochemical characterization of highly purified leucine-rich repeat kinases 1 and 2 demonstrates formation of homodimers.
22899650 2012 LRRK2 functions as a Wnt signaling scaffold, bridging cytosolic proteins and membrane-localized LRP6.
22337768 2012 EGFR-dependent phosphorylation of leucine-rich repeat kinase LRRK1 is important for proper endosomal trafficking of EGFR.
20697350 2010 The proximal signaling network of the BCR-ABL1 oncogene shows a modular organization.
20144646 2010 Heterodimerization of Lrrk1-Lrrk2: Implications for LRRK2-associated Parkinson disease.
19712061 2009 Homo- and heterodimerization of ROCO kinases: LRRK2 kinase inhibition by the LRRK2 ROCO fragment.
18272292 2008 Developmental regulation of leucine-rich repeat kinase 1 and 2 expression in the brain and other rodent and human organs: Implications for Parkinson's disease.
18045479 2007 Dynamic and redundant regulation of LRRK2 and LRRK1 expression.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17394548 2007 Mutations in LRRK2/dardarin associated with Parkinson disease are more toxic than equivalent mutations in the homologous kinase LRRK1.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17324517 2007 Variants in the LRRK1 gene and susceptibility to Parkinson's disease in Norway.
17225181 2007 Leucine-rich repeat kinase 1: a paralog of LRRK2 and a candidate gene for Parkinson's disease.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
16243488 2006 LRRK1 protein kinase activity is stimulated upon binding of GTP to its Roc domain.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14654223 2003 Roc, a Ras/GTPase domain in complex proteins.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11347906 2001 Prediction of the coding sequences of unidentified human genes. XX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.