Property Summary

NCBI Gene PubMed Count 28
PubMed Score 41.55
PubTator Score 49.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Liver Cirrhosis, Experimental 769 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Obesity 678 0.0 1.1
Disease Target Count Z-score Confidence
Gingival recession 13 4.008 2.0

Expression

  Differential Expression (38)

Disease log2 FC p
acute myeloid leukemia 1.200 4.2e-02
acute quadriplegic myopathy 1.495 1.1e-03
aldosterone-producing adenoma -1.108 3.8e-02
Amyotrophic lateral sclerosis 1.034 1.2e-03
astrocytic glioma 1.800 5.0e-03
atypical teratoid / rhabdoid tumor -1.700 2.1e-03
Breast cancer -1.400 1.1e-04
breast carcinoma -1.100 1.4e-18
diabetes mellitus -1.100 1.8e-02
ependymoma 2.000 2.3e-03
fascioscapulohumeral muscular dystrophy 1.048 7.2e-03
gastric carcinoma 1.100 2.1e-02
glioblastoma 1.200 9.5e-03
group 3 medulloblastoma -1.100 3.8e-02
hereditary spastic paraplegia -1.002 2.8e-02
intraductal papillary-mucinous adenoma (... 1.800 2.9e-03
intraductal papillary-mucinous carcinoma... 1.700 3.2e-03
intraductal papillary-mucinous neoplasm ... 1.500 3.2e-02
invasive ductal carcinoma -1.500 1.3e-03
juvenile dermatomyositis 1.783 3.6e-10
lung adenocarcinoma -1.400 7.7e-18
lung cancer -1.200 3.1e-03
lung carcinoma 1.100 2.0e-09
medulloblastoma, large-cell -1.500 1.3e-03
non-small cell lung cancer -1.715 1.5e-17
oligodendroglioma 1.800 1.7e-03
osteosarcoma 1.646 4.4e-09
ovarian cancer -1.600 5.5e-06
pancreatic cancer 1.200 3.9e-03
pancreatic ductal adenocarcinoma liver m... 1.385 1.1e-02
pediatric high grade glioma 1.100 9.0e-03
Pick disease 1.200 1.1e-06
pituitary cancer -1.100 2.0e-04
progressive supranuclear palsy 1.500 6.5e-03
psoriasis 1.100 5.5e-03
subependymal giant cell astrocytoma 1.599 2.4e-03
tuberculosis and treatment for 3 months 1.300 7.3e-05
ulcerative colitis 1.500 3.7e-07

 GWAS Trait (1)

Protein-protein Interaction (7)

Gene RIF (12)

AA Sequence

MTSPAAAQSREIDCLSPEAQKLAEARLAAKRAARAEAREIRMKELERQQKEEDSERYSRRSRRNTSASDE      1 - 70
DERMSVGSRGSLRVEERPEKDFTEKGSRNMPGLSAATLASLGGTSSRRGSGDTSISIDTEASIREIKELN     71 - 140
ELKDQIQDVEGKYMQGLKEMKDSLAEVEEKYKKAMVSNAQLDNEKTNFMYQVDTLKDMLLELEEQLAESR    141 - 210
RQYEEKNKEFEREKHAHSILQFQFAEVKEALKQREEMLEKHGIILNSEIATNGETSDTLNNVGYQGPTKM    211 - 280
TKEELNALKSTGDGTLGRASEVEVKNEIVANVGKREILHNTEKEQHTEDTVKDCVDIEVFPAGENTEDQK    281 - 350
SSEDTAPFLGTLAGATYEEQVQSQILESSSLPENTVQVESNEVMGAPDDRTRTPLEPSNCWSDLDGGNHT    351 - 420
ENVGEAAVTQVEEQAGTVASCPLGHSDDTVYHDDKCMVEVPQELETSTGHSLEKEFTNQEAAEPKEVPAH    421 - 490
STEVGRDHNEEEGEETGLRDEKPIKTEVPGSPAGTEGNCQEATGPSTVDTQNEPLDMKEPDEEKSDQQGE    491 - 560
ALDSSQKKTKNKKKKNKKKKSPVPVETLKDVKKELTYQNTDLSEIKEEEQVKSTDRKSAVEAQNEVTENP    561 - 630
KQKIAAESSENVDCPENPKIKLDGKLDQEGDDVQTAAEEVLADGDTLDFEDDTVQSSGPRAGGEELDEGV    631 - 700
AKDNAKIDGATQSSPAEPKSEDADRCTLPEHESPSQDISDACEAESTERCEMSEHPSQTVRKALDSNSLE    701 - 770
NDDLSAPGREPGHFNPESREDTRGGNEKGKSKEDCTMS                                    771 - 808
//

Text Mined References (39)

PMID Year Title