Property Summary

NCBI Gene PubMed Count 11
PubMed Score 3.50
PubTator Score 2.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
astrocytic glioma -1.500 4.8e-03
ependymoma -1.100 4.1e-02
oligodendroglioma -1.400 7.3e-03
osteosarcoma 1.805 5.7e-04
group 3 medulloblastoma -2.200 1.8e-03
cystic fibrosis 1.801 1.5e-06
medulloblastoma, large-cell -2.000 1.3e-03
tuberculosis -1.200 2.1e-05
intraductal papillary-mucinous adenoma (... -1.400 1.7e-03
intraductal papillary-mucinous carcinoma... -1.600 2.7e-03
intraductal papillary-mucinous neoplasm ... -1.200 2.2e-02
sarcoidosis 1.100 2.2e-02
interstitial cystitis 1.600 2.8e-05
ductal carcinoma in situ -1.200 1.6e-03
invasive ductal carcinoma -1.700 1.9e-03
ulcerative colitis 2.100 4.4e-05
ovarian cancer 1.900 2.8e-12

Gene RIF (3)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
15184384 fad158 has a role in regulating adipocyte differentiation
15094057 identified four genes, named TA-LRRP, AD158, LRRC5, and FLJ23420, as unknown LRRC8-like genes

AA Sequence

MIPVTEFRQFSEQQPAFRVLKPWWDVFTDYLSVAMLMIGVFGCTLQVMQDKIICLPKRVQPAQNHSSLSN      1 - 70
VSQAVASTTPLPPPKPSPANPITVEMKGLKTDLDLQQYSFINQMCYERALHWYAKYFPYLVLIHTLVFML     71 - 140
CSNFWFKFPGSSSKIEHFISILGKCFDSPWTTRALSEVSGEDSEEKDNRKNNMNRSNTIQSGPEDSLVNS    141 - 210
QSLKSIPEKFVVDKSTAGALDKKEGEQAKALFEKVKKFRLHVEEGDILYAMYVRQTVLKVIKFLIIIAYN    211 - 280
SALVSKVQFTVDCNVDIQDMTGYKNFSCNHTMAHLFSKLSFCYLCFVSIYGLTCLYTLYWLFYRSLREYS    281 - 350
FEYVRQETGIDDIPDVKNDFAFMLHMIDQYDPLYSKRFAVFLSEVSENKLKQLNLNNEWTPDKLRQKLQT    351 - 420
NAHNRLELPLIMLSGLPDTVFEITELQSLKLEIIKNVMIPATIAQLDNLQELSLHQCSVKIHSAALSFLK    421 - 490
ENLKVLSVKFDDMRELPPWMYGLRNLEELYLVGSLSHDISRNVTLESLRDLKSLKILSIKSNVSKIPQAV    491 - 560
VDVSSHLQKMCIHNDGTKLVMLNNLKKMTNLTELELVHCDLERIPHAVFSLLSLQELDLKENNLKSIEEI    561 - 630
VSFQHLRKLTVLKLWHNSITYIPEHIKKLTSLERLSFSHNKIEVLPSHLFLCNKIRYLDLSYNDIRFIPP    631 - 700
EIGVLQSLQYFSITCNKVESLPDELYFCKKLKTLKIGKNSLSVLSPKIGNLLFLSYLDVKGNHFEILPPE    701 - 770
LGDCRALKRAGLVVEDALFETLPSDVREQMKTE                                         771 - 803
//

Text Mined References (15)

PMID Year Title
26824658 2016 LRRC8 Proteins Form Volume-Regulated Anion Channels that Sense Ionic Strength.
24790029 2014 Identification of LRRC8 heteromers as an essential component of the volume-regulated anion channel VRAC.
24529757 2014 Genome-wide association study combining pathway analysis for typical sporadic amyotrophic lateral sclerosis in Chinese Han populations.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22532330 2012 LRRC8 proteins share a common ancestor with pannexins, and may form hexameric channels involved in cell-cell communication.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19946888 2010 Defining the membrane proteome of NK cells.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15564382 2004 Fad24, a mammalian homolog of Noc3p, is a positive regulator in adipocyte differentiation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15184384 2004 The novel gene fad158, having a transmembrane domain and leucine-rich repeat, stimulates adipocyte differentiation.
15094057 2004 LRRC8 involved in B cell development belongs to a novel family of leucine-rich repeat proteins.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.