Property Summary

NCBI Gene PubMed Count 25
PubMed Score 39.36
PubTator Score 24.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma 1.200 9.1e-03
atypical teratoid / rhabdoid tumor -1.300 1.9e-07
intraductal papillary-mucinous neoplasm ... 1.600 1.7e-03
lung adenocarcinoma -1.200 1.8e-10
medulloblastoma, large-cell -1.600 2.3e-06
oligodendroglioma 1.100 7.2e-03
primary pancreatic ductal adenocarcinoma 1.625 1.0e-02
Rheumatoid arthritis 1.100 2.2e-02
spina bifida -1.262 3.1e-02

 OMIM Phenotype (1)

Gene RIF (13)

AA Sequence

MIPVTELRYFADTQPAYRILKPWWDVFTDYISIVMLMIAVFGGTLQVTQDKMICLPCKWVTKDSCNDSFR      1 - 70
GWAAPGPEPTYPNSTILPTPDTGPTGIKYDLDRHQYNYVDAVCYENRLHWFAKYFPYLVLLHTLIFLACS     71 - 140
NFWFKFPRTSSKLEHFVSILLKCFDSPWTTRALSETVVEESDPKPAFSKMNGSMDKKSSTVSEDVEATVP    141 - 210
MLQRTKSRIEQGIVDRSETGVLDKKEGEQAKALFEKVKKFRTHVEEGDIVYRLYMRQTIIKVIKFILIIC    211 - 280
YTVYYVHNIKFDVDCTVDIESLTGYRTYRCAHPLATLFKILASFYISLVIFYGLICMYTLWWMLRRSLKK    281 - 350
YSFESIREESSYSDIPDVKNDFAFMLHLIDQYDPLYSKRFAVFLSEVSENKLRQLNLNNEWTLDKLRQRL    351 - 420
TKNAQDKLELHLFMLSGIPDTVFDLVELEVLKLELIPDVTIPPSIAQLTGLKELWLYHTAAKIEAPALAF    421 - 490
LRENLRALHIKFTDIKEIPLWIYSLKTLEELHLTGNLSAENNRYIVIDGLRELKRLKVLRLKSNLSKLPQ    491 - 560
VVTDVGVHLQKLSINNEGTKLIVLNSLKKMANLTELELIRCDLERIPHSIFSLHNLQEIDLKDNNLKTIE    561 - 630
EIISFQHLHRLTCLKLWYNHIAYIPIQIGNLTNLERLYLNRNKIEKIPTQLFYCRKLRYLDLSHNNLTFL    631 - 700
PADIGLLQNLQNLAITANRIETLPPELFQCRKLRALHLGNNVLQSLPSRVGELTNLTQIELRGNRLECLP    701 - 770
VELGECPLLKRSGLVVEEDLFNTLPPEVKERLWRADKEQA                                  771 - 810
//

Text Mined References (31)

PMID Year Title