Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary


No data available


  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -1.900 3.8e-05
astrocytoma -1.500 4.6e-29
Astrocytoma, Pilocytic -1.400 2.0e-06
atypical teratoid / rhabdoid tumor -1.100 1.3e-03
glioblastoma -1.400 3.0e-07
group 3 medulloblastoma -1.100 4.1e-02
invasive ductal carcinoma 1.100 2.5e-02
medulloblastoma, large-cell -1.900 2.3e-04
oligodendroglioma -1.400 3.9e-20

 Compartment GO Term (2)

AA Sequence

AHQRGSSSWMCPSDPSSQMVLMTSGLGDSLLAETEM                                      281 - 316

Text Mined References (3)

PMID Year Title