Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytoma -1.500 4.6e-29
glioblastoma multiforme -1.500 8.5e-32
oligodendroglioma -1.400 3.9e-20
sonic hedgehog group medulloblastoma -1.800 2.0e-05
atypical teratoid / rhabdoid tumor -1.100 1.3e-03
medulloblastoma, large-cell -1.900 2.3e-04
adult high grade glioma -1.900 3.8e-05
pilocytic astrocytoma -1.400 3.6e-06
invasive ductal carcinoma 1.100 2.5e-02

Synonym

Accession Q5JTD7
Symbols C6orf154

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 Compartment GO Term (2)

AA Sequence

MLPSSIQISGEPLSGAEVRDICRGLRDNAVRLLSLRGCRLCDRDFGRICRALAGATSLAQLNLNLGVVSS      1 - 70
PSRIKQLAEALRTNRSIQSLFLHGSPLTDAGLALLNPALALHPALVALDLGDCMLGDEAINLICGLLPPD     71 - 140
GAKSGLKELTLSANPGITPKGWSRLAIAVAHSSQVRVLNLDYNPLGDHVAGMLAVAVASSRTLEVLDLEG    141 - 210
TGLTNQSAQTLLDMVENYPTALRSLVLAENSISPELQQQICDLLSEGEEEEEVAGGAGDTQEWERGREPA    211 - 280
AHQRGSSSWMCPSDPSSQMVLMTSGLGDSLLAETEM                                      281 - 316
//

Text Mined References (3)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.