Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.13
PubTator Score 0.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma 1.400 7.4e-03
ependymoma 1.100 2.8e-02
oligodendroglioma 1.700 6.8e-03
osteosarcoma 1.568 2.2e-03
glioblastoma 1.600 4.4e-03
medulloblastoma, large-cell 1.100 2.1e-03
adrenocortical carcinoma -1.102 7.5e-07
Breast cancer 2.200 3.7e-02
pediatric high grade glioma 1.400 1.1e-03
aldosterone-producing adenoma -1.480 4.8e-02

AA Sequence

MEEAGAAVVTAGEAELNWSRLSVSTETLESELEARGEERRGAREALLRLLLPHNRLVSLPRALGSGFPHL      1 - 70
QLLDVSGNALTALGPELLALRGLRTLLAKNNRLGGPSALPKGLAQSPLCRSLQVLNLSGNCFQEVPASLL     71 - 140
ELRALQTLSLGGNQLQSIPAEIENLQSLECLYLGGNFIKEIPPELGNLPSLNYLVLCDNKIQSIPPQLSQ    141 - 210
LHSLRSLSLHNNLLTYLPREILNLIHLEELSLRGNPLVVRFVRDLTYDPPTLLELAARTIKIRNISYTPY    211 - 280
DLPGNLLRYLGSASNCPNPKCGGVYFDCCVRQIKFVDFCGKYRLPLMHYLCSPECSSPCSSASHSSTSQS    281 - 350
ESDSEDEASVAARRMQKVLLG                                                     351 - 371
//

Text Mined References (9)

PMID Year Title
22566634 2012 The genetic architecture of economic and political preferences.
22174851 2011 Genomewide association study for determinants of HIV-1 acquisition and viral set point in HIV-1 serodiscordant couples with quantified virus exposure.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
16381901 2006 The LIFEdb database in 2006.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11076863 2000 DNA cloning using in vitro site-specific recombination.