Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -1.900 7.1e-05
Astrocytoma, Pilocytic -1.100 9.3e-04
atypical teratoid / rhabdoid tumor -1.300 2.5e-03
glioblastoma -1.200 1.2e-04
group 3 medulloblastoma 1.100 3.1e-02
intraductal papillary-mucinous neoplasm ... 1.200 1.4e-02
medulloblastoma, large-cell -1.400 6.2e-03
osteosarcoma -1.923 1.6e-06
ovarian cancer 1.300 1.0e-02
posterior fossa group A ependymoma 1.100 6.0e-06

AA Sequence

MGNSALRAHVETAQKTGVFQLKDRGLTEFPADLQKLTSNLRTIDLSNNKIESLPPLLIGKFTLLKSLSLN      1 - 70
NNKLTVLPDEICNLKKLETLSLNNNHLRELPSTFGQLSALKTLSLSGNQLGALPPQLCSLRHLDVMDLSK     71 - 140
NQIRSIPDSVGELQVIELNLNQNQISQISVKISCCPRLKILRLEENCLELSMLPQSILSDSQICLLAVEG    141 - 210
NLFEIKKLRELEGYDKYMERFTATKKKFA                                             211 - 239
//

Text Mined References (13)

PMID Year Title