Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
osteosarcoma -1.923 1.6e-06
glioblastoma -1.600 5.5e-04
atypical teratoid / rhabdoid tumor -1.300 2.5e-03
medulloblastoma, large-cell -1.400 6.2e-03
intraductal papillary-mucinous neoplasm ... 1.200 1.4e-02
adult high grade glioma -1.900 7.1e-05
group 3 medulloblastoma 1.100 3.1e-02
pilocytic astrocytoma -1.100 1.4e-03
posterior fossa group A ependymoma 1.100 6.0e-06
ovarian cancer 1.300 1.0e-02

Synonym

Accession Q8N9N7 Q7Z2Z6 Q8N1T6
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MGNSALRAHVETAQKTGVFQLKDRGLTEFPADLQKLTSNLRTIDLSNNKIESLPPLLIGKFTLLKSLSLN      1 - 70
NNKLTVLPDEICNLKKLETLSLNNNHLRELPSTFGQLSALKTLSLSGNQLGALPPQLCSLRHLDVMDLSK     71 - 140
NQIRSIPDSVGELQVIELNLNQNQISQISVKISCCPRLKILRLEENCLELSMLPQSILSDSQICLLAVEG    141 - 210
NLFEIKKLRELEGYDKYMERFTATKKKFA                                             211 - 239
//

Text Mined References (13)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25255805 2014 Global profiling of co- and post-translationally N-myristoylated proteomes in human cells.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21269460 2011 Initial characterization of the human central proteome.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.