Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.22
PubTator Score 0.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8520 2.0e-05
dermatomyositis 966 1.1e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Down syndrome 499 3.008 1.5

Expression

  Differential Expression (2)

Disease log2 FC p
dermatomyositis 1.400 1.1e-03
ovarian cancer -1.200 2.0e-05

 GO Function (1)

Gene RIF (1)

AA Sequence

MAAAAVSESWPELELAERERRRELLLTGPGLEERVRAAGGQLPPRLFTLPLLHYLEVSGCGSLRAPGPGL      1 - 70
AQGLPQLHSLVLRRNALGPGLSPELGPLPALRVLDLSGNALEALPPGQGLGPAEPPGLPQLQSLNLSGNR     71 - 140
LRELPADLARCAPRLQSLNLTGNCLDSFPAELFRPGALPLLSELAAADNCLRELSPDIAHLASLKTLDLS    141 - 210
NNQLSEIPAELADCPKLKEINFRGNKLRDKRLEKMVSGCQTRSILEYLRVGGRGGGKGKGRAEGSEKEES    211 - 280
RRKRRERKQRREGGDGEEQDVGDAGRLLLRVLHVSENPVPLTVRVSPEVRDVRPYIVGAVVRGMDLQPGN    281 - 350
ALKRFLTSQTKLHEDLCEKRTAATLATHELRAVKGPLLYCARPPQDLKIVPLGRKEAKAKELVRQLQLEA    351 - 420
EEQRKQKKRQSVSGLHRYLHLLDGNENYPCLVDADGDVISFPPITNSEKTKVKKTTSDLFLEVTSATSLQ    421 - 490
ICKDVMDALILKMAEMKKYTLENKEEGSLSDTEADAVSGQLPDPTTNPSAGKDGPSLLVVEQVRVVDLEG    491 - 560
SLKVVYPSKADLATAPPHVTVVR                                                   561 - 583
//

Text Mined References (19)

PMID Year Title