Property Summary

NCBI Gene PubMed Count 11
PubMed Score 2.80
PubTator Score 0.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.200 5.4e-06
ependymoma 1.100 1.8e-06
glioblastoma 1.100 2.0e-04
group 4 medulloblastoma 1.100 2.4e-03
malignant mesothelioma 2.100 8.9e-06
medulloblastoma, large-cell 1.100 7.4e-05
pediatric high grade glioma 1.200 1.6e-04
tuberculosis and treatment for 6 months -1.100 3.2e-05

AA Sequence

MAAPEAWRARSCWFCEVAAATTMEATSREAAPAKSSASGPNAPPALFELCGRAVSAHMGVLESGVWALPG      1 - 70
PILQSILPLLNIYYLERIEETALKKGLSTQAIWRRLWDELMKTRPSSLESVTCWRAKFMEAFFSHVLRGT     71 - 140
IDVSSDRRLCDQRFSPLLHSSRHVRQLTICNMLQGATELVAEPNRRVLETLASSLHTLKFRHLLFSDVAA    141 - 210
QQSLRQLLHQLIHHGAVSQVSLYSWPVPESALFILILTMSAGFWQPGPGGPPCRLCGEASRGRAPSRDEG    211 - 280
SLLLGSRRPRRDAAERCAAALMASRRKSEAKQMPRAAPATRVTRRSTQESLTAGGTDLKRELHPPATSHE    281 - 350
APGTKRSPSAPAATSSASSSTSSYKRAPASSAPQPKPLKRFKRAAGKKGARTRQGPGAESEDLYDFVFIV    351 - 420
AGEKEDGEEMEIGEVACGALDGSDPSCLGLPALEASQRFRSISTLELFTVPLSTEAALTLCHLLSSWVSL    421 - 490
ESLTLSYNGLGSNIFRLLDSLRALSGQAGCRLRALHLSDLFSPLPILELTRAIVRALPLLRVLSIRVDHP    491 - 560
SQRDNPGVPGNAGPPSHIIGDEEIPENCLEQLEMGFPRGAQPAPLLCSVLKASGSLQQLSLDSATFASPQ    561 - 630
DFGLVLQTLKEYNLALKRLSFHDMNLADCQSEVLFLLQNLTLQEITFSFCRLFEKRPAQFLPEMVAAMKG    631 - 700
NSTLKGLRLPGNRLGNAGLLALADVFSEDSSSSLCQLDISSNCIKPDGLLEFAKRLERWGRGAFGHLRLF    701 - 770
QNWLDQDAVTAREAIRRLRATCHVVSDSWDSSQAFADYVSTM                                771 - 812
//

Text Mined References (19)

PMID Year Title