Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.10
PubTator Score 0.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
acute quadriplegic myopathy 1158 7.7e-06
Parkinson's disease 392 1.6e-03
lung cancer 4740 2.5e-03
interstitial lung disease 298 3.1e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (4)

Disease log2 FC p
acute quadriplegic myopathy 1.228 7.7e-06
interstitial lung disease -1.200 3.1e-02
lung cancer 1.200 2.5e-03
Parkinson's disease -1.500 1.6e-03

AA Sequence

MSRLKRIAGQDLRAGFKAGGRDCGTSVPQGLLKAARKSGQLNLSGRNLSEVPQCVWRINVDIPEEANQNL      1 - 70
SFGATERWWEQTDLTKLIISNNKLQSLTDDLRLLPALTVLDIHDNQLTSLPSAIRELENLQKLNVSHNKL     71 - 140
KILPEEITNLRNLKCLYLQHNELTCISEGFEQLSNLEDLDLSNNHLTTVPASFSSLSSLVRLNLSSNELK    141 - 210
SLPAEINRMKRLKHLDCNSNLLETIPPELAGMESLELLYLRRNKLRFLPEFPSCSLLKELHVGENQIEML    211 - 280
EAEHLKHLNSILVLDLRDNKLKSVPDEIILLRSLERLDLSNNDISSLPYSLGNLHLKFLALEGNPLRTIR    281 - 350
REIISKGTQEVLKYLRSKIKDDGPSQSESATETAMTLPSESRVNIHAIITLKILDYSDKQATLIPDEVFD    351 - 420
AVKSNIVTSINFSKNQLCEIPKRMVELKEMVSDVDLSFNKLSFISLELCVLQKLTFLDLRNNFLNSLPEE    421 - 490
MESLVRLQTINLSFNRFKMLPEVLYRIFTLETILISNNQVGSVDPQKMKMMENLTTLDLQNNDLLQIPPE    491 - 560
LGNCVNLRTLLLDGNPFRVPRAAILMKGTAAILEYLRDRIPT                                561 - 602
//

Text Mined References (12)

PMID Year Title