Property Summary

NCBI Gene PubMed Count 37
PubMed Score 36.43
PubTator Score 53.18

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
lung cancer -1.500 9.2e-03
adrenocortical carcinoma -1.392 8.9e-05
Breast cancer 1.200 2.3e-10
cystic fibrosis -3.774 1.8e-07
fibroadenoma -1.100 2.7e-02
interstitial cystitis 1.700 5.8e-05
intraductal papillary-mucinous adenoma (... -1.600 4.0e-05
intraductal papillary-mucinous carcinoma... -2.000 3.1e-05
intraductal papillary-mucinous neoplasm ... -1.800 1.2e-03
lung adenocarcinoma -1.400 3.4e-12
lung carcinoma -1.500 1.0e-06
non-small cell lung cancer -1.986 3.9e-18
ovarian cancer 1.200 2.0e-04
pancreatic cancer 1.400 5.4e-03
primary pancreatic ductal adenocarcinoma 1.737 2.1e-03
psoriasis 1.200 1.5e-03

Gene RIF (22)

AA Sequence

MRPQILLLLALLTLGLAAQHQDKVPCKMVDKKVSCQVLGLLQVPSVLPPDTETLDLSGNQLRSILASPLG      1 - 70
FYTALRHLDLSTNEISFLQPGAFQALTHLEHLSLAHNRLAMATALSAGGLGPLPRVTSLDLSGNSLYSGL     71 - 140
LERLLGEAPSLHTLSLAENSLTRLTRHTFRDMPALEQLDLHSNVLMDIEDGAFEGLPRLTHLNLSRNSLT    141 - 210
CISDFSLQQLRVLDLSCNSIEAFQTASQPQAEFQLTWLDLRENKLLHFPDLAALPRLIYLNLSNNLIRLP    211 - 280
TGPPQDSKGIHAPSEGWSALPLSAPSGNASGRPLSQLLNLDLSYNEIELIPDSFLEHLTSLCFLNLSRNC    281 - 350
LRTFEARRLGSLPCLMLLDLSHNALETLELGARALGSLRTLLLQGNALRDLPPYTFANLASLQRLNLQGN    351 - 420
RVSPCGGPDEPGPSGCVAFSGITSLRSLSLVDNEIELLRAGAFLHTPLTELDLSSNPGLEVATGALGGLE    421 - 490
ASLEVLALQGNGLMVLQVDLPCFICLKRLNLAENRLSHLPAWTQAVSLEVLDLRNNSFSLLPGSAMGGLE    491 - 560
TSLRRLYLQGNPLSCCGNGWLAAQLHQGRVDVDATQDLICRFSSQEEVSLSHVRPEDCEKGGLKNINLII    561 - 630
ILTFILVSAILLTTLAACCCVRRQKFNQQYKA                                          631 - 662
//

Text Mined References (38)

PMID Year Title