Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession A6NM36
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 Compartment GO Term (0)

 HCA RNA Cell Line (1)

AA Sequence

MGARQSRASSKDKGPKRMLFTGRRQKFSPWDDALLSGRDPRSLLKRGMHHVSFSLVTRGMTDIPDFLWGL      1 - 70
SEVQKLNLSHNQLRVLPPEVGKLTRIVVLNLCGNRLKSLPREVSLLQCLKVLFVNMNCLTEVPAELSLCR     71 - 140
KLEVLSLSHNCLSQLPACFADLSRLRKLNLSNNFFAHIPMCVFSLKELIFLHVGSNRLENIAESIQHLAS    141 - 210
LQIFIAEGNNIHSFPRSLCLVTSLELLNLNNNDIQTLPSELHLLCRLVRIAWNPMDKGLHISHNPLSKPL    211 - 280
PELVEGGLEMLFGYLKDKKHT                                                     281 - 301
//

Text Mined References (1)

PMID Year Title
16177791 2005 DNA sequence and analysis of human chromosome 18.