Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.07
PubTator Score 0.10

Knowledge Summary

Patent

No data available

Expression

 Compartment GO Term (1)

AA Sequence

MYSSGWPAGAAEPRHGRGRELAQALGCMHGAPSQLASLSLAHCSSLKSRPELEHQASGTKDACPEPQGPS      1 - 70
LLTLRALQELDLTACSKLTDASLAKVLQFLQLRQLSLSLLPELTDNGLVAVARGCPSLEHLALSHCSRLS     71 - 140
DKGWAQAASSWPRLQHLNLSSCSQLIEQTLDAIGQACRQLRVLDVATCPGINMAAVRRFQAQLPQVSCVQ    141 - 210
SRFVGGADLTLTL                                                             211 - 223
//

Text Mined References (5)

PMID Year Title