Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.08
PubTator Score 0.14

Knowledge Summary

Patent

No data available

Gene RIF (1)

AA Sequence

MALRAPALLPLLLLLLPLRAAGCPAACRCYSATVECGALRLRVVPLGIPPGTQTLFLQDNNIARLEPGAL      1 - 70
APLAALRRLYLHNNSLRALEAGAFRAQPRLLELALTSNRLRGLRSGAFVGLAQLRVLYLAGNQLARLLDF     71 - 140
TFLHLPRLQELHLQENSIELLEDQALAGLSSLALLDLSRNQLGTISREALQPLASLQVLRLTENPWRCDC    141 - 210
ALHWLGAWIKEGGQRLLTSRDRKIMCAEPPRLALQSLLDVSHSSLICIPPSVHVQPLELTANLGEDLRVA    211 - 280
CQASGYPQPLVTWRKVPQPREGRPRAQAQLEGGLLGLGGHSASDTGSGMLFLSNITLAHAGKYECEASNA    281 - 350
GGAARVPFRLLVNASRQQPQQPAQPPPPAARPAGSEPRPEAGSMAFRALGVATQTAIAAAIALLALTALL    351 - 420
LVAMICRRRRRRKKARGPPGEGALFVNDYLDGPCTFAQLEELRDERGHEMFVINRSKPLFAEGPAEAPAD    421 - 490
CGPEQGAGPGLRVPPPVAYEIHC                                                   491 - 513
//

Text Mined References (6)

PMID Year Title