Property Summary

NCBI Gene PubMed Count 12
PubMed Score 1.61
PubTator Score 1.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
malignant mesothelioma -6.500 1.3e-08
astrocytic glioma -2.700 9.2e-03
oligodendroglioma -2.600 1.4e-02
psoriasis -1.500 1.0e-02
osteosarcoma -1.180 3.6e-02
medulloblastoma -3.300 1.6e-08
atypical teratoid / rhabdoid tumor -2.700 5.6e-04
glioblastoma -2.800 1.3e-05
medulloblastoma, large-cell -3.300 6.2e-06
primitive neuroectodermal tumor -3.100 7.5e-05
limb girdle muscular dystrophy 2A -1.352 9.0e-05
Duchenne muscular dystrophy -1.222 6.5e-07
Atopic dermatitis -1.700 5.9e-04
pediatric high grade glioma -1.600 1.1e-02
lung adenocarcinoma 2.400 7.5e-03
ductal carcinoma in situ -1.200 3.5e-03
invasive ductal carcinoma -1.300 1.9e-02
ovarian cancer -1.600 2.5e-09
pituitary cancer -1.900 7.0e-05

Gene RIF (2)

PMID Text
22082156 Knockdown of leucine rich repeat containing 2 (LRRC2) by siRNA enhances the early stages of HIV-1 replication in HeLa-CD4 cells infected with viral pseudotypes HIV89.6R and HIV8.2N
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MGHKVVVFDISVIRALWETRVKKHKAWQKKEVERLEKSALEKIKEEWNFVAECRRKGIPQAVYCKNGFID      1 - 70
TSVRLLDKIERNTLTRQSSLPKDRGKRSSAFVFELSGEHWTELPDSLKEQTHLREWYISNTLIQIIPTYI     71 - 140
QLFQAMRILDLPKNQISHLPAEIGCLKNLKELNVGFNYLKSIPPELGDCENLERLDCSGNLELMELPFEL    141 - 210
SNLKQVTFVDISANKFSSVPICVLRMSNLQWLDISSNNLTDLPQDIDRLEELQSFLLYKNKLTYLPYSML    211 - 280
NLKKLTLLVVSGDHLVELPTALCDSSTPLKFVSLMDNPIDNAQCEDGNEIMESERDRQHFDKEVMKAYIE    281 - 350
DLKERESVPSYTTKVSFSLQL                                                     351 - 371
//

Text Mined References (12)

PMID Year Title
21606681 2011 Leucine-rich repeat (LRR) proteins: integrators of pattern recognition and signaling in immunity.
20616063 2011 Human leucine-rich repeat proteins: a genome-wide bioinformatic categorization and functional analysis in innate immunity.
20420713 2010 Identifying mRNA targets of microRNA dysregulated in cancer: with application to clear cell Renal Cell Carcinoma.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16432833 2006 Down regulation of 3p genes, LTF, SLC38A3 and DRR1, upon growth of human chromosome 3-mouse fibrosarcoma hybrids in severe combined immunodeficiency mice.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12461651 2002 Comparative human/murine sequence analysis of the common eliminated region 1 from human 3p21.3.
11896456 2002 The transcriptional map of the common eliminated region 1 (C3CER1) in 3p21.3.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.