Property Summary

NCBI Gene PubMed Count 10
PubMed Score 224.49
PubTator Score 27.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
osteosarcoma 1.252 2.5e-03
primary pancreatic ductal adenocarcinoma 1.268 3.8e-03
non-small cell lung cancer 2.243 4.1e-12
colon cancer 2.300 1.0e-03
pancreatic cancer 1.400 1.6e-03
breast carcinoma 1.700 5.4e-21
Breast cancer 3.100 6.1e-13
lung adenocarcinoma 1.200 1.8e-03
invasive ductal carcinoma 3.658 1.5e-04
ductal carcinoma in situ 2.700 2.3e-03
ovarian cancer 2.400 6.0e-03

Gene RIF (3)

PMID Text
18385238 Tumor antigen LRRC15 impedes adenoviral infection: implications for virus-based cancer therapy are presented.
16098915 Lib may contribute to regulation of cell-matrix adhesion interactions with respect to astrocyte recruitment around senile plaques in Alzheimer's disease brain
12923058 LRRC15 is induced by EWS-WT1(+KTS) in the tumor DSRCT and may play a role in cellular invasion.

AA Sequence

MPLKHYLLLLVGCQAWGAGLAYHGCPSECTCSRASQVECTGARIVAVPTPLPWNAMSLQILNTHITELNE      1 - 70
SPFLNISALIALRIEKNELSRITPGAFRNLGSLRYLSLANNKLQVLPIGLFQGLDSLESLLLSSNQLLQI     71 - 140
QPAHFSQCSNLKELQLHGNHLEYIPDGAFDHLVGLTKLNLGKNSLTHISPRVFQHLGNLQVLRLYENRLT    141 - 210
DIPMGTFDGLVNLQELALQQNQIGLLSPGLFHNNHNLQRLYLSNNHISQLPPSVFMQLPQLNRLTLFGNS    211 - 280
LKELSPGIFGPMPNLRELWLYDNHISSLPDNVFSNLRQLQVLILSRNQISFISPGAFNGLTELRELSLHT    281 - 350
NALQDLDGNVFRMLANLQNISLQNNRLRQLPGNIFANVNGLMAIQLQNNQLENLPLGIFDHLGKLCELRL    351 - 420
YDNPWRCDSDILPLRNWLLLNQPRLGTDTVPVCFSPANVRGQSLIIINVNVAVPSVHVPEVPSYPETPWY    421 - 490
PDTPSYPDTTSVSSTTELTSPVEDYTDLTTIQVTDDRSVWGMTQAQSGLAIAAIVIGIVALACSLAACVG    491 - 560
CCCCKKRSQAVLMQMKAPNEC                                                     561 - 581
//

Text Mined References (11)

PMID Year Title
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18385238 2008 Tumor antigen LRRC15 impedes adenoviral infection: implications for virus-based cancer therapy.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16098915 2005 Lib, transcriptionally induced in senile plaque-associated astrocytes, promotes glial migration through extracellular matrix.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12923058 2003 Identification of a DNA-binding site and transcriptional target for the EWS-WT1(+KTS) oncoprotein.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11785964 2002 A novel member of the leucine-rich repeat superfamily induced in rat astrocytes by beta-amyloid.