Property Summary

NCBI Gene PubMed Count 72
PubMed Score 141.66
PubTator Score 93.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
cutaneous lupus erythematosus 1.100 7.9e-03
psoriasis 2.000 8.4e-16
osteosarcoma -1.116 3.3e-02
posterior fossa group A ependymoma -1.500 5.7e-08
atypical teratoid / rhabdoid tumor -1.700 1.8e-04
glioblastoma -1.100 1.0e-02
Atopic dermatitis 1.100 3.8e-04
tuberculosis and treatment for 6 months 1.400 3.3e-04
non-small cell lung cancer 1.572 2.3e-15
intraductal papillary-mucinous carcinoma... 2.300 1.8e-02
intraductal papillary-mucinous neoplasm ... 3.200 2.1e-03
colon cancer 3.200 2.0e-04
lung cancer 3.300 3.3e-06
active Crohn's disease 2.605 1.3e-02
active ulcerative colitis 2.107 2.3e-02
adult high grade glioma -1.300 1.7e-04
group 3 medulloblastoma 2.400 2.6e-05
primary Sjogren syndrome 1.200 6.9e-03
subependymal giant cell astrocytoma -1.411 1.1e-02
lung adenocarcinoma 1.300 1.1e-08
Breast cancer 2.700 8.7e-09
Pick disease 1.100 3.9e-05
invasive ductal carcinoma 1.600 4.9e-03
ovarian cancer 1.600 2.3e-04
pituitary cancer -1.100 1.8e-04

Protein-protein Interaction (1)

Gene RIF (48)

PMID Text
26817215 two SNPs (rs3737984 and rs2297660) in ApoER2 gene had significant association with dyslipidemia in Thai ethnic
26800564 ApoER2 contributes cooperatively with endothelial cell protein C receptor and protease activated receptor 1 to APC-initiated endothelial antiapoptotic and barrier protective signaling.
24867879 A novel TACGC risk haplotype in the LRP8 gene that is present in patients with CAD and MI but not in normal controls.
24844606 results of this study demonstrated the presence of reelin, its receptors VLDLR and ApoER2 as well as Dab1 in the ENS and might indicate a novel role of the reelin system in regulating neuronal plasticity and pre-synaptic functions in the ENS.
24344333 Data suggest that PS1/gamma-secretase-dependent processing of the reelin receptor ApoER2 inhibits reelin expression and may regulate its signaling.
24076391 ectopic expression of HIC1 in U2OS and MDA-MB-231 cell lines decreases expression of the ApoER2 and VLDLR genes, encoding two canonical tyrosine kinase receptors for Reelin.
23739027 By incorporating the information from bioinformatics and RNA expression analyses, we identified at least two of the most promising risk genes for alcohol dependence: APOER2 and UBAP2
23524007 TCCGC haplotype at the 3'-terminal block of the LRP8 gene confers a protective role in the development of familial and early-onset coronary artery disease and/or myocardial infarction.
22889673 In a Chinese unrelated Han population, variants within the LRP8 gene do not convey the risk of developing Parkinson's disease.
22589174 results identify LRP8 as a novel positive factor of canonical Wnt signaling pathway
22419519 Variation in genes encoding proteins at the gateway of Reelin signaling: ligands RELN and APOE, their common receptors APOER2 and VLDLR, and adaptor DAB1, was examined.
22404453 genetic variant R952Q of LRP8 is associated with increased plasma TG levels in patients who are overweight and have premature CAD/MI and history of smoking.
22170052 activation of VLDLR and apoER2 by reelin and apoE induces ABCA1 expression and cholesterol efflux via a Dab1-PI3K-PKCzeta-Sp1 signaling cascade.
21601501 In later stages of cerebral cortical development, ApoER2 is expressed earlier than VLDLR in migrating neurons.
21347244 ApoEr2 plays important roles in structure and function of CNS synapses and dendritic spines
21316997 LRP8 gene polymorphisms influence plasma cholesterol levels as well as size and composition of LDL particles
21157031 Deficient sLRP-amyloid-beta binding might precede and correlate later in disease with an increase in the tau/Abeta42 CSF ratio and global cognitive decline in mild cognitive impairment individuals converting into Alzheimer's disease.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20493228 the expression of ApoER2 may serve as a trait marker for major depressive disorder.
20331378 Observational study of gene-disease association. (HuGE Navigator)
20208369 There were seven polymorphisms in apoE receptor 2 in Japanese sporadic Alzheimer disease patients, but no association of these polymorphisms with Alzheimers.
19948739 Differential functions of ApoER2 and very low density lipoprotein receptor in Reelin signaling depend on differential sorting of the receptors.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19720620 ApoEr2 regulates cell movement, and both X11alpha and Reelin enhance this effect.
19661487 apolipoprotein E receptor 2 (ApoER2, LRP8), a member of the LDL receptor family, is a platelet receptor for FXI.
19439088 Our data suggest that LRP8 R952Q variant may have an additive effect to APOE epsilon2/epsilon3/epsilon4 genotype in determining ApoE concentrations and risk of MI in an Italian population
19116273 ligation of ApoER2 by APC signals via Dab1 phosphorylation and subsequent activation of PI3K and Akt and inactivation of GSK3beta, thereby contributing to APC's beneficial effects on cells.
18592168 Study showed no evidence for association of genetic variants in the LRP8 gene with familial and sporadic myocardial infarction.
18592168 Observational study of gene-disease association. (HuGE Navigator)
18489431 protein C and APC may directly promote cell signaling in other cells by binding to ApoER2 and/or GPIbalpha
18089558 Fyn, due in part to its effects on Dab1, regulates the phosphorylation, trafficking, and processing of APP and apoEr2.
18039658 the activity of PCSK9 and its binding affinity on VLDLR and ApoER2 does not depend on the presence of LDLR.
17847002 Observational study of gene-disease association. (HuGE Navigator)
17847002 A nonconservative substitution, R952Q, in LRP8 was significantly associated with susceptibility to premature CAD and/or MI by use of both population-based and family-based designs.
17614163 However, this polymorphism increased the risk of AD conferred by the MAPK8IP1 G allele.
17614163 Observational study of gene-disease association. (HuGE Navigator)
17470198 The presence of three splice variants of ApoER2 on platelets was confirmed by immuno-blotting, with ApoER2Delta4-5 being the most abundantly expressed splice variant.
16951405 The effect of Dab1 on APP and apoEr2 processing in transfected cells and primary neurons is reported.
16642433 Observational study of gene-disease association. (HuGE Navigator)
16642433 In conclusion, results from the two independent samples of black women provide consistent evidence that SNP rs2297660 in LRP8 is associated with fetal growth.
16481437 Reelin signals by binding to two transmembrane receptors, apolipoprotein E receptor 2 (Apoer2) and very-low-density lipoprotein receptor.
16332682 ApoEr2 can form a multiprotein complex with NMDA receptor subunits and PSD95
16034672 Complete molecular structure examined by nuclear magnetic resonance.
15950758 The effects of apoE on receptor proteolysis were mediated by the ligand binding domain of the receptor. We suggest that signaling promoted by these receptors depends in part on these regulated proteolytic events.
12950167 Data show that the apolipoprotein E receptor 2 binding domain of apolipoprotein E is in the 1-165 amino terminal region, whereas the carboxy terminal 230-299 region of apoE is required for efficient initial association with phospholipids.
12871934 Sequential proteolytic processing of murine ApoER2 results in the release of its intracellular domain by the protease gamma-secretase. The prior cleavage of its extracellular domain is determined by the glycosylation state of the receptor.
12621059 transmembrane domain and PXXP motif excludes it from carrying out clathrin-mediated endocytosis
12399018 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGLPEPGPLRLLALLLLLLLLLLLQLQHLAAAAADPLLGGQGPAKDCEKDQFQCRNERCIPSVWRCDEDD      1 - 70
DCLDHSDEDDCPKKTCADSDFTCDNGHCIHERWKCDGEEECPDGSDESEATCTKQVCPAEKLSCGPTSHK     71 - 140
CVPASWRCDGEKDCEGGADEAGCATLCAPHEFQCGNRSCLAAVFVCDGDDDCGDGSDERGCADPACGPRE    141 - 210
FRCGGDGGGACIPERWVCDRQFDCEDRSDEAAELCGRPGPGATSAPAACATASQFACRSGECVHLGWRCD    211 - 280
GDRDCKDKSDEADCPLGTCRGDEFQCGDGTCVLAIKHCNQEQDCPDGSDEAGCLQGLNECLHNNGGCSHI    281 - 350
CTDLKIGFECTCPAGFQLLDQKTCGDIDECKDPDACSQICVNYKGYFKCECYPGYEMDLLTKNCKAAAGK    351 - 420
SPSLIFTNRHEVRRIDLVKRNYSRLIPMLKNVVALDVEVATNRIYWCDLSYRKIYSAYMDKASDPKEQEV    421 - 490
LIDEQLHSPEGLAVDWVHKHIYWTDSGNKTISVATVDGGRRRTLFSRNLSEPRAIAVDPLRGFMYWSDWG    491 - 560
DQAKIEKSGLNGVDRQTLVSDNIEWPNGITLDLLSQRLYWVDSKLHQLSSIDFSGGNRKTLISSTDFLSH    561 - 630
PFGIAVFEDKVFWTDLENEAIFSANRLNGLEISILAENLNNPHDIVIFHELKQPRAPDACELSVQPNGGC    631 - 700
EYLCLPAPQISSHSPKYTCACPDTMWLGPDMKRCYRAPQSTSTTTLASTMTRTVPATTRAPGTTVHRSTY    701 - 770
QNHSTETPSLTAAVPSSVSVPRAPSISPSTLSPATSNHSQHYANEDSKMGSTVTAAVIGIIVPIVVIALL    771 - 840
CMSGYLIWRNWKRKNTKSMNFDNPVYRKTTEEEDEDELHIGRTAQIGHVYPAAISSFDRPLWAEPCLGET    841 - 910
REPEDPAPALKELFVLPGEPRSQLHQLPKNPLSELPVVKSKRVALSLEDDGLP                     911 - 963
//

Text Mined References (74)

PMID Year Title
26817215 2015 Apolipoprotein E receptor 2 Gene Polymorphisms Associated with Dyslipidemia among Thai Population.
26800564 2016 Apolipoprotein E Receptor 2 Mediates Activated Protein C-Induced Endothelial Akt Activation and Endothelial Barrier Stabilization.
24867879 2014 A novel molecular diagnostic marker for familial and early-onset coronary artery disease and myocardial infarction in the LRP8 gene.
24844606 2014 Expression and regulation of reelin and its receptors in the enteric nervous system.
24344333 2014 ApoER2 processing by presenilin-1 modulates reelin expression.
24076391 2013 The Reelin receptors ApoER2 and VLDLR are direct target genes of HIC1 (Hypermethylated In Cancer 1).
23739027 2013 Exome-wide association study of replicable nonsynonymous variants conferring risk for alcohol dependence.
23524007 2013 Multi-allelic haplotype association identifies novel information different from single-SNP analysis: a new protective haplotype in the LRP8 gene is against familial and early-onset CAD and MI.
23382219 2013 Structural basis for endosomal trafficking of diverse transmembrane cargos by PX-FERM proteins.
23192594 2013 Gene-environment interactions and obesity traits among postmenopausal African-American and Hispanic women in the Women's Health Initiative SHARe Study.
22889673 2012 Association analysis of LRP8 SNP rs3820198 and rs5174 with Parkinson's disease in Han Chinese population.
22589174 2012 LRP8 mediates Wnt/?-catenin signaling and controls osteoblast differentiation.
22419519 2012 Impact of the Reelin signaling cascade (ligands-receptors-adaptor complex) on cognition in schizophrenia.
22404453 2012 Genetic variant R952Q in LRP8 is associated with increased plasma triglyceride levels in patients with early-onset CAD and MI.
22170052 2012 Up-regulation of ATP binding cassette transporter A1 expression by very low density lipoprotein receptor and apolipoprotein E receptor 2.
21601501 2011 ApoER2 and VLDLR in the developing human telencephalon.
21554715 2011 Similarities and differences in structure, expression, and functions of VLDLR and ApoER2.
21347244 2011 ApoE receptor 2 regulates synapse and dendritic spine formation.
21316997 2011 Investigation of LRP8 gene in 1p31 QTL linked to LDL peak particle diameter in the Quebec family study.
21157031 2011 Impaired lipoprotein receptor-mediated peripheral binding of plasma amyloid-? is an early biomarker for mild cognitive impairment preceding Alzheimer's disease.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20493228 2010 Reduced expression of apolipoprotein E receptor type 2 in peripheral blood lymphocytes from patients with major depressive disorder.
20427281 2010 The E3 ubiquitin ligase IDOL induces the degradation of the low density lipoprotein receptor family members VLDLR and ApoER2.
20331378 2010 Large-scale candidate gene analysis of spontaneous clearance of hepatitis C virus.
20208369 2010 Polymorphisms in the human apolipoprotein E receptor 2 gene in Japanese sporadic Alzheimer's disease patients.
19948739 2010 Differential functions of ApoER2 and very low density lipoprotein receptor in Reelin signaling depend on differential sorting of the receptors.
19946888 2010 Defining the membrane proteome of NK cells.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19720620 2010 The cytoplasmic adaptor protein X11alpha and extracellular matrix protein Reelin regulate ApoE receptor 2 trafficking and cell movement.
19661487 2009 Identification of coagulation factor XI as a ligand for platelet apolipoprotein E receptor 2 (ApoER2).
19439088 2009 Additive effect of LRP8/APOER2 R952Q variant to APOE epsilon2/epsilon3/epsilon4 genotype in modulating apolipoprotein E concentration and the risk of myocardial infarction: a case-control study.
19282863 2009 Association of candidate gene polymorphisms with chronic kidney disease in Japanese individuals with hypertension.
19116273 2009 Activated protein C ligation of ApoER2 (LRP8) causes Dab1-dependent signaling in U937 cells.
19056482 2009 Association of a polymorphism of the apolipoprotein E gene with chronic kidney disease in Japanese individuals with metabolic syndrome.
18592168 2008 Lack of association of genetic variants in the LRP8 gene with familial and sporadic myocardial infarction.
18489431 2008 Protein C supports platelet binding and activation under flow: role of glycoprotein Ib and apolipoprotein E receptor 2.
18089558 2008 Fyn modulation of Dab1 effects on amyloid precursor protein and ApoE receptor 2 processing.
18039658 2008 The proprotein convertase PCSK9 induces the degradation of low density lipoprotein receptor (LDLR) and its closest family members VLDLR and ApoER2.
17847002 2007 An LRP8 variant is associated with familial and premature coronary artery disease and myocardial infarction.
17614163 2009 Low-density lipoprotein receptor-related protein 8 gene polymorphisms and dementia.
17470198 2007 Platelets express three different splice variants of ApoER2 that are all involved in signaling.
16951405 2006 DAB1 and Reelin effects on amyloid precursor protein and ApoE receptor 2 trafficking and processing.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16642433 2006 Polymorphism in maternal LRP8 gene is associated with fetal growth.
16481437 2006 Functional dissection of Reelin signaling by site-directed disruption of Disabled-1 adaptor binding to apolipoprotein E receptor 2: distinct roles in development and synaptic plasticity.
16332682 2006 Apolipoprotein E receptor 2 interactions with the N-methyl-D-aspartate receptor.
16034672 2005 A complete backbone assignment of the apolipoprotein E LDL receptor binding domain.
15950758 2005 Regulation of ApoE receptor proteolysis by ligand binding.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15459198 2004 Binding of low density lipoprotein to platelet apolipoprotein E receptor 2' results in phosphorylation of p38MAPK.
15313836 2004 Loss of apolipoprotein E receptor LR11 in Alzheimer disease.
14732905 2004 Premature myocardial infarction novel susceptibility locus on chromosome 1P34-36 identified by genomewide linkage analysis.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12950167 2003 Domains of apoE required for binding to apoE receptor 2 and to phospholipids: implications for the functions of apoE in the brain.
12899622 2003 Differential binding of ligands to the apolipoprotein E receptor 2.
12871934 2003 Differential glycosylation regulates processing of lipoprotein receptors by gamma-secretase.
12824284 2003 A model for modulation of leptin activity by association with clusterin.
12807892 2003 Dimers of beta 2-glycoprotein I increase platelet deposition to collagen via interaction with phospholipids and the apolipoprotein E receptor 2'.
12681505 2003 Apolipoprotein E (apoE) isoforms differentially induce nitric oxide production in endothelial cells.
12670700 2003 Binding of purified Reelin to ApoER2 and VLDLR mediates tyrosine phosphorylation of Disabled-1.
12621059 2003 The transmembrane domain and PXXP motifs of ApoE receptor 2 exclude it from carrying out clathrin-mediated endocytosis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12426372 2002 A secreted soluble form of ApoE receptor 2 acts as a dominant-negative receptor and inhibits Reelin signaling.
12399018 2002 Low-density lipoprotein receptor-related protein 8 (apolipoprotein E receptor 2) gene polymorphisms in Alzheimer's disease.
12169628 2002 The PX-domain protein SNX17 interacts with members of the LDL receptor family and modulates endocytosis of the LDL receptor.
12167620 2002 Reelin and ApoE receptors cooperate to enhance hippocampal synaptic plasticity and learning.
11369809 2001 Localization of apolipoprotein E receptor 2 to caveolae in the plasma membrane.
11152697 2001 Identification of a novel exon in apolipoprotein E receptor 2 leading to alternatively spliced mRNAs found in cells of the vascular wall but not in neuronal tissue.
10571240 1999 Reelin is a ligand for lipoprotein receptors.
10508213 1999 Identification and characterization of LRP8 (apoER2) in human blood platelets.
10231386 1999 Expression in vitro of alternatively spliced variants of the messenger RNA for human apolipoprotein E receptor-2 identified in human tissues by ribonuclease protection assays.
10218790 1999 Expression and alternate splicing of apolipoprotein E receptor 2 in brain.
9079678 1997 Exon/intron organization, chromosome localization, alternative splicing, and transcription units of the human apolipoprotein E receptor 2 gene.
8626535 1996 Human apolipoprotein E receptor 2. A novel lipoprotein receptor of the low density lipoprotein receptor family predominantly expressed in brain.