Property Summary

NCBI Gene PubMed Count 162
PubMed Score 249.07
PubTator Score 175.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma 1.100 1.2e-02
osteosarcoma 3.031 2.2e-07
atypical teratoid / rhabdoid tumor 1.700 1.9e-05
glioblastoma 1.400 1.6e-05
medulloblastoma, large-cell 1.200 1.6e-04
primitive neuroectodermal tumor 1.200 2.7e-03
hereditary spastic paraplegia -1.041 1.1e-02
adrenocortical carcinoma 1.156 3.5e-03
lung cancer 1.600 6.5e-05
sonic hedgehog group medulloblastoma 1.200 1.7e-04
posterior fossa group A ependymoma 1.100 2.9e-07
Pick disease -1.300 7.3e-04
progressive supranuclear palsy -1.500 1.5e-02
acute myeloid leukemia -1.800 3.4e-02

Protein-protein Interaction (9)

Gene RIF (133)

PMID Text
26797284 Accordingly, we propose that the anti-fibrotic activity of adiponectin may be mediated through AdipoR1/R2 receptors
26387593 Loss-of-Function Mutations in the WNT Co-receptor LRP6 Cause Autosomal-Dominant Oligodontia.
26239517 Results suggest that miR-126 functions as a tumor-suppressive miRNA by targeting LRP6 regulating Wnt/beta-catenin signaling pathway in papillary thyroid carcinoma.
26120271 LRP6 and VEGF levels in the vitreous body from patients with proliferative diabetic retinopathy were increased and correlated mutually.
26063413 miR513c functions as a tumor suppressor miRNA, mediated predominantly through the direct suppression of the expression of LRP6.
26031789 LRP6 variants may be associated with risk of ischaemic stroke.
25959626 findings suggest that rescuing LRP5/6-mediated Wnt signaling improves neuronal cell survival and reduces tau phosphorylation, which support the hypothesis that Wnt signaling might be an attractive therapeutic strategy for managing AD
25902418 Lrp6 binds to Frizzled, preventing Frz-regulated non-canonical Wnt pathway activation and further non-canonical pathway-mediated tumour metastasis.
25783012 No mutations in LRP5 and LRP6 could be identified
25546815 LRP6 variants outside of YWTD repeats could potentially predispose embryos to neural tube defectss, whereas Lrp6 modulation of Wnt/planar cell polarity signaling would be more essential than its canonical pathway role in neural tube closure.
25500543 LRP6 phosphorylation by ERK1/2 may provide a unique point of convergence between KRAS/MAPK and Wnt/beta-catenin signalings during oncogenesis
25425204 The interaction between Wnt isoforms and their LRP6 cognate receptor depends on the jutting loop present in Wnt3a but absent in Wnt5b.
25358452 Particularly for TNBC associated with Skp2/LRP6 overexpression.
25301448 High LRP6 expression is associated with glioblastoma.
25242217 LRP6 (and Wnt signaling) are significantly downregulated in Alzheimer's disease brains.
25240815 the metastasis and angiogenesis functions of miR-126-3p were mediated by LRP6 and PIK3R2.
25143377 The LRP6 tyrosine mutant increased in signaling activation in response to Wnt3a/beta-catenin stimulation.
24906453 Data provides the first evidence that LRP6 rs2302685 polymorphism is associated with an increased risk of MI in Chinese subjects, and the association is more evident among younger individuals, which probably due to the elevated LDL-C levels.
24843317 The LRP6 rs10845498 SNP is associated with a reduced risk of lung SCC, while tobacco smoke increases the risk
24743782 The results suggested that the lack of affinity between human DKK3 and human LRP5/6 results from: i) insertion of the 7 amino acids, and ii) P258 in human DKK3.
24704686 Data indicate that miR-202 suppresses the expression of LRP6 (low-density lipoprotein receptor-related protein 6) by binding to the 3'-untranslated region (UTR) of its mRNA.
24607787 Rottlerin is a novel LRP6 inhibitor, promoting protein degradation.
24457908 LRP6 may influence glucose metabolism in type II fibers of human skeletal muscles.
24427284 results demonstrated that the novel loss-of-function variants identified in this study might contribute to disease liability in a subset of coronary artery disease (CAD) and defects in Wnt signal activation might be important contributing factors for the onset of CAD
24412065 GSK3 is sequestered into multivesicular bodies through and interaction between p120-catenin/cadherin and LRP5/6.
24392029 Syndecan-1 modulates the cancer stem cell phenotype via regulation of the Wnt and IL-6/STAT3 signaling pathways
24289859 LRP6 was identified as a new target of miR-183, and restoration of the expression of LRP6 rescues the effects induced by miR-183 in retinoblastoma cells.
24265322 Data show that beta-arrestins regulate Wnt3a-induced low density lipoprotein receptor-related protein 6 (Lrp6) phosphorylation by the regulation of the membrane dynamics of Amer1.
24203697 This study demonstrates the association of rare and novel missense mutations in LRP6 that is an inhibitor rather than an activator of the non-canonical planar cell polarity pathway with human neural tube defects.
23987510 Lypd6 appears to control Lrp6 activation specifically in membrane rafts, which is essential for downstream signaling.
23811937 Data indicate that upregulated miR-126 upon coxsackievirus B3 (CVB3) infection targets SPRED1, LRP6, and WRCH1 genes, mediating cross-talk between ERK1/2 and Wnt/beta-catenin pathways, and thus promoting viral replication.
23773994 Results indicate that Lrp6 mediates not only canonical Wnt signaling, but can also modulate non-canonical pathways involving RhoA-dependent mechanisms to impact neurulation, possibly through intracellular complexes with DAAM1.
23754096 Pantoprazole treatment caused a decrease in phospho-LRP6, but not in LRP6.
23703864 Americans with early onset familial coronary artery disease and metabolic syndrome and healthy Northern European controls were screened for nonconservative mutations in LRP6; 3 novel mutations were identified which cosegregated with the metabolic traits in the kindreds of affected subjects and none in controls
23666756 A novel role of kallistatin in preventing breast tumor growth and mobility by direct interaction with LRP6.
23638027 Wnt3a-induced transcriptional responses and induction of alkaline phosphatase activity, an early marker of osteoblast differentiation, require the Wnt co-receptors LRP5 and LRP6
23395167 the LRP6(R611C) mutation diminishes TCF7L2-dependent transcription of the IR while it increases the stability of IGFR and enhances mTORC1 activity.
23306204 SOX9 regulates low density lipoprotein receptor-related protein 6 (LRP6) and T-cell factor 4 (TCF4) expression and Wnt/beta-catenin activation in breast cancer.
23302227 results show that Cav-1 interacts with LRP6 to generate an integrated signaling module that leads to the activation of IGF-IR/IR and results in stimulation of Akt-mTORC1 signaling and aerobic glycolysis in prostate cancer
23218566 The LRP6delta3 isoform is a novel splice variant which shows diminished wnt signaling activity and is associated with Alzheimer's disease.
23077088 Data indicate that LRP6, BCL2L14, DUSP16, CREBL2, and CDKN1B were involed in centromeric (12p11.21-12p13.2) deletion in ETV6-RUNX1 B-cell precursor acute lymphoblastic leukemia (BCP-ALL).
22907437 Arf modulates LRP6 phosphorylation for the transduction of Wnt/beta-catenin signaling.
22871567 These results demonstrate LRP6 as the predominant Wnt3a LRP-receptor in human mesenchymal stem cells, which cannot be substituted by LRP5.
22696217 peptide derived from the loop 2 region of sclerostin blocked the interaction of sclerostin with LRP5/6 and also inhibited Wnt1 but not Wnt3A or Wnt9B signaling. This suggests that these Wnts interact with LRP6 in different ways
22606268 sLRP6E1E2, by inhibiting interaction between Wnt and its receptor, suppressed Wnt-induced cell proliferation and epithelial-to-mesenchymal transition.
22589387 Crystal structures of the LRP6 ectodomain in complex with DKK1, along with mutagenesis studies, provide considerable insights into the molecular basis for DKK-mediated inhibition and Wnt signaling through LRP5/6
22570728 overexpression of LRP6 contributes to the hyperactivation of the Wnt/beta-catenin signaling pathway in human HCCs and suggest it may play a role in hepatocarcinogenesis.
22490400 The C allele of the rs11054731 within the LRP6 gene was associated with increased risk and extent of CAD in Chinese.
22393312 LRP6 as a new candidate gene in ileal Crohn's Disease; an association of a non-synonymous SNP (rs2302685; Ile1062Val) with early onset ileal Crohn's Disease
22372892 The conformation of the LRP6 intracellular domain is elongated before activation; this is based on the intrusion of the Frizzled complex into the ensemble space of the proline rich region of LRP6, which alters the shape of its available ensemble space.
22128165 LRP6 protein regulates low density lipoprotein (LDL) receptor-mediated LDL uptake.
22000856 The Wnts bound to either portion of the LRP6 ectodomain likely bear a similar spatial relationship to Frizzled coreceptors.
22000855 The LDL-receptor-related protein 6 (LRP6), alongside Frizzled receptors, transduces Wnt signaling across the plasma membrane.
21984209 Results provide key insights for understanding LRP5/6 structure and the interaction of LRP5/6 with DKK1, as well as for drug discovery.
21944579 The consensus E1 binding sequence motif is important for DKK1 and SOST binding to LRP6 and for inhibitory function.
21887268 These studies uncover a new and important molecular tuning mechanism for differential regulation of LRP5 and LRP6 phosphorylation and signaling activity.
21536646 these results identified TMEM198 as a membrane scaffold protein that promotes LRP6 phosphorylation and Wnt signaling activation.
21397183 Two structural and functional domains of MESD required for proper folding and trafficking of LRP5/LRP6.
21245321 findings implicate LRP6 as a critical modulator of PDGF-dependent regulation of cell cycle in smooth muscle and indicate that loss of this function contributes to development of early atherosclerosis in humans
20974802 direct phosphorylation of LRP6 by MAPKs provides a unique point for convergence between WNT/beta-catenin signaling and mitogenic pathways
20926594 We found common polymorphisms of LRP5 associated with osteoporotic fractures, and polymorphisms of the LRP6 gene associated with BMD, thus suggesting them as likely candidates to contribute to the explaination of the hereditary influence on osteoporosis.
20926594 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20846389 The mRNA expression levels of DKK-1 binding receptor LRP5/6 and Krm1/2 in SCs from patients with MM were significantly higher than those in myeloma cells and in SCs from healthy donors.
20676368 Results suggest that LRP6-ICD can differentially modulate Wnt pathway transcriptional activity depending upon its subcellular localization and differential protein-protein interactions.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20543981 results reveal a novel role for Dkk1 in preventing Wnt ligand-induced LRP6 down-regulation and contribute significantly to our understanding of Dkk1 function in Wnt/LRP6 signaling
20460648 Gbetagamma activates GSK3 to promote LRP6-mediated beta-catenin transcriptional activity
20390408 Observational study of gene-disease association. (HuGE Navigator)
20388731 Dishevelled signals through LRP5/6 in human cells and Drosophila embryos.
20351274 SERPINA3K is a high-affinity, endogenous antagonist of LRP6
20194742 Expression of the Wnt signaling coreceptor LRP6 is up-regulated in a subpopulation of human breast cancers.
20137080 The canonical Wnt-signaling proteins LRP6 and Dvl2 and Dvl3 are involved in the regulation of beta-catenin.
20093360 analysis of the frizzled8.Wnt3a.LRP6 signaling complex reveals multiple Wnt and Dkk1 binding sites on LRP6
20057906 Observational study of gene-disease association. (HuGE Navigator)
20053636 Results suggest that Dkk1 induces the internalization of LRP6 to suppress its phosphorylation in the lipid raft and allows subsequent recycling of LRP6 so that it can be reused for signaling.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19898734 results suggest that SNP in LRP6, is not associated with bone mineral density in the Slovenian population
19898734 Observational study of gene-disease association. (HuGE Navigator)
19881541 found that mammary glands from mouse mammary tumor virus-LRP6 mice exhibit significant Wnt activation evidenced by the translocation of beta-catenin from membrane to cytoplasmic/nuclear fractions.
19833493 LRP6 variants with impaired Wnt/beta-catenin signaling appear to be involved in early coronary and carotid artery atherosclerosis, at least in hypertensive patients.
19833493 Observational study of gene-disease association. (HuGE Navigator)
19801552 Results identify GRK5/6 as novel kinases for the single transmembrane receptor LRP6 during Wnt signaling.
19711366 PPP(S/T)P motif phosphorylation of the free LRP6 intracellular domain is not required to activate the Wnt/beta-catenin pathway and attenuate GSK3beta activity
19692168 Observational study of gene-disease association. (HuGE Navigator)
19667113 A common variant in low-density lipoprotein receptor-related protein 6 gene (LRP6) is associated with LDL-cholesterol.
19667113 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19477926 Results identify the first propeller domain as a novel regulatory domain for DKK1 binding to LRP6.
19453261 Observational study of gene-disease association. (HuGE Navigator)
19339249 These studies reveal unique properties of the LRP6 beta-propeller domains and provide novel tools to understand LRP6 function in ligand binding and Wnt signaling.
19293931 propose a working model that Axin recruitment to the phosphorylated LRP6 places GSK3 in the vicinity of multiple phosphorylated PPPSPXS motifs
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19107203 Phosphorylated LRP6/5 both recruits and directly inhibits GSK3beta using two distinct portions of its cytoplasmic sequence.
19015224 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18981475 PTH treatment led to phosphorylation of LRP6 and an increase in amount of beta-catenin in osteoblasts with a concurrent increase in bone formation in rat. Thus, LRP6 coreceptor is a key element of the PTH signaling that regulates osteoblast activity.
18838381 BAMBI interacts with Wnt receptor Frizzled5, coreceptor LRP6, and Dishevelled2 and increases the interaction between Frizzled5 and Dishevelled2
18772438 Wnt3a stimulates formation of phosphatidylinositol 4,5-bisphosphate through frizzled & dishevelled; in turn PtdIns (4,5)P2 regulated phosphorylation of LRP6 at Thr1479 & Ser1490; study reveals signaling mechanism for Wnt to regulate LRP6 phosphorylation
18717822 The authors show that LRP6 can indeed form a complex with anthrax toxin receptors, and that this interaction plays a role both in Wnt signalling and in anthrax toxin endocytosis.
18676680 Observational study of gene-disease association. (HuGE Navigator)
18606139 WNT3 and DKK1 regulate distinct internalization pathways of LRP6 to tune the activation of beta catenin signaling.
18524778 analysis of the structural basis of the interaction between Dkk and low density lipoprotein receptor-related protein (LRP) 5/6
18505732 DKK1 inhibition of LRP6 is independent of LRP6 internalization and degradation
18502762 Kremen may not be essential for Dkk1-mediated Wnt antagonism and Kremen may only play a role when cells express a high level of LRP5/6
18493104 We found no evidence for a substantial effect of LRP5 or LRP6 SNPs on susceptibility to type 2 diabetes or clinical characteristics of diabetic subjects in Japanese population.
18493104 Observational study of gene-disease association. (HuGE Navigator)
18406176 No association was seen between FRZB, LRP5 and LRP6 variants with radiographic osteoarthritic outcomes in two population-based cohorts
18406176 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
18378904 propose that palmitoylation serves to tilt the long, 23-residue transmembrane domain of LRP6 with respect to the plane of membrane to prevent a hydrophobic mismatch and subsequent recognition by the ER quality control
18362152 PPPSP motifs represents a built-in amplifier for Wnt signaling by the LRP6 family of receptors.
18350154 data argue against a human-specific role for LRP6 in anthrax toxin entry and suggest instead that involvement of this protein may be restricted to certain cell types independently of their species of origin
18083125 each LRP6 PPPS/TP motif contributes in a combinatorial fashion to activate the canonical Wnt-beta-catenin pathway
18077588 Both Fz and Dvl functions are critical for Wnt-induced Lrp6 phosphorylation through Fz-Lrp6 interaction. Axin, a key scaffolding protein in the Wnt pathway, is required for Lrp6 phosphorylation via its ability to recruit Gsk3.
17804805 RSPO1 regulates Wnt signaling by inhibiting internalization of LRP6.
17765217 While secreted Wise either synergizes or inhibits the Wnt signals depending on the partner ligand, ER-retained Wise consistently blocks the Wnt pathway. ER-retained Wise reduces LRP6 on the cell surface, making cells less susceptible to the Wnt signal.
17698587 Results identify a novel feedback mechanism by which Wnt, including Wnt3a, negatively regulates LRP6 at the mRNA level.
17569865 it is proposed that Wnts induce coclustering of receptors and Dvl in LRP6-signalosomes, which in turn triggers LRP6 phosphorylation to promote Axin recruitment and beta-catenin stabilization
17517621 Observational study of gene-disease association. (HuGE Navigator)
17517621 report the association between common LRP6 variants and late-onset Alzheimer's disease in a multicenter case-control series as well as in a large family-based series ascertained
17376403 The finding that GRB10 interferes with the binding of Axin to LRP6 indicated a possible molecular mechanism by which the overexpression of GRB10 suppresses Wnt signaling.
17332414 results link a mutation in LRP6 which encodes a co-receptor in the Wnt signaling pathway to coronary artery disease and multiple cardiovascular risk factors
17326769 These findings suggest a novel mechanism for LRP6 in Wnt signaling: induction of ectodomain shedding of LRP6, followed by the gamma-secretase involved proteolytic releasing its intracellular domain.
16989816 Mesd and LRP6 modulate Wnt signaling.
16564009 LRP6 is required for anthrax toxin lethality; LRP6 enables toxin internalization by interacting at the cell surface with PA receptors
16513652 active CKIepsilon generation may induce a negative feedback loop by phosphorylation of sites on LRP5/6 that modulate axin binding and hence beta-catenin degradation
16384981 Observational study of gene-disease association. (HuGE Navigator)
16384981 These data suggest that LRP6, VEGF, and VLDLR may play a role in the risk of developing (age-related macular degeneration)AMD.
16365045 a direct interaction between LRP6 and GSK3 results in an attenuation of GSK3 activity
16355283 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16263759 Together our results show that in addition to serving as a folding chaperone, Mesd can function as a receptor antagonist by inhibiting ligand binding to mature LRP6.
15908424 SOST antagonizes Wnt signaling by binding to the extracellular domain of the Wnt coreceptors LRP5 and LRP6 and disrupting Wnt-induced Frizzled-LRP complex formation.
15516984 LRP6 may function as a potential oncogenic protein by modulating Wnt/beta-catenin signaling
15271658 role for an LDL receptor-related protein in the regulation of vascular smooth muscle cell proliferation and survival through the evolutionary conserved Wnt signaling cascade.
12897152 Wnt canonical signaling through LRP6 establishes a novel mechanism for receptor activation which is opposite to the general paradigm of ligand-induced receptor oligomerization

AA Sequence

MGAVLRSLLACSFCVLLRAAPLLLYANRRDLRLVDATNGKENATIVVGGLEDAAAVDFVFSHGLIYWSDV      1 - 70
SEEAIKRTEFNKTESVQNVVVSGLLSPDGLACDWLGEKLYWTDSETNRIEVSNLDGSLRKVLFWQELDQP     71 - 140
RAIALDPSSGFMYWTDWGEVPKIERAGMDGSSRFIIINSEIYWPNGLTLDYEEQKLYWADAKLNFIHKSN    141 - 210
LDGTNRQAVVKGSLPHPFALTLFEDILYWTDWSTHSILACNKYTGEGLREIHSDIFSPMDIHAFSQQRQP    211 - 280
NATNPCGIDNGGCSHLCLMSPVKPFYQCACPTGVKLLENGKTCKDGATELLLLARRTDLRRISLDTPDFT    281 - 350
DIVLQLEDIRHAIAIDYDPVEGYIYWTDDEVRAIRRSFIDGSGSQFVVTAQIAHPDGIAVDWVARNLYWT    351 - 420
DTGTDRIEVTRLNGTMRKILISEDLEEPRAIVLDPMVGYMYWTDWGEIPKIERAALDGSDRVVLVNTSLG    421 - 490
WPNGLALDYDEGKIYWGDAKTDKIEVMNTDGTGRRVLVEDKIPHIFGFTLLGDYVYWTDWQRRSIERVHK    491 - 560
RSAEREVIIDQLPDLMGLKATNVHRVIGSNPCAEENGGCSHLCLYRPQGLRCACPIGFELISDMKTCIVP    561 - 630
EAFLLFSRRADIRRISLETNNNNVAIPLTGVKEASALDFDVTDNRIYWTDISLKTISRAFMNGSALEHVV    631 - 700
EFGLDYPEGMAVDWLGKNLYWADTGTNRIEVSKLDGQHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGK    701 - 770
PKIDRAAMDGSERTTLVPNVGRANGLTIDYAKRRLYWTDLDTNLIESSNMLGLNREVIADDLPHPFGLTQ    771 - 840
YQDYIYWTDWSRRSIERANKTSGQNRTIIQGHLDYVMDILVFHSSRQSGWNECASSNGHCSHLCLAVPVG    841 - 910
GFVCGCPAHYSLNADNRTCSAPTTFLLFSQKSAINRMVIDEQQSPDIILPIHSLRNVRAIDYDPLDKQLY    911 - 980
WIDSRQNMIRKAQEDGSQGFTVVVSSVPSQNLEIQPYDLSIDIYSRYIYWTCEATNVINVTRLDGRSVGV    981 - 1050
VLKGEQDRPRAVVVNPEKGYMYFTNLQERSPKIERAALDGTEREVLFFSGLSKPIALALDSRLGKLFWAD   1051 - 1120
SDLRRIESSDLSGANRIVLEDSNILQPVGLTVFENWLYWIDKQQQMIEKIDMTGREGRTKVQARIAQLSD   1121 - 1190
IHAVKELNLQEYRQHPCAQDNGGCSHICLVKGDGTTRCSCPMHLVLLQDELSCGEPPTCSPQQFTCFTGE   1191 - 1260
IDCIPVAWRCDGFTECEDHSDELNCPVCSESQFQCASGQCIDGALRCNGDANCQDKSDEKNCEVLCLIDQ   1261 - 1330
FRCANGQCIGKHKKCDHNVDCSDKSDELDCYPTEEPAPQATNTVGSVIGVIVTIFVSGTVYFICQRMLCP   1331 - 1400
RMKGDGETMTNDYVVHGPASVPLGYVPHPSSLSGSLPGMSRGKSMISSLSIMGGSSGPPYDRAHVTGASS   1401 - 1470
SSSSSTKGTYFPAILNPPPSPATERSHYTMEFGYSSNSPSTHRSYSYRPYSYRHFAPPTTPCSTDVCDSD   1471 - 1540
YAPSRRMTSVATAKGYTSDLNYDSEPVPPPPTPRSQYLSAEENYESCPPSPYTERSYSHHLYPPPPSPCT   1541 - 1610
DSS                                                                      1611 - 1613
//

Text Mined References (167)

PMID Year Title
27013965 2016 Protective LRRK2 R1398H Variant Enhances GTPase and Wnt Signaling Activity.
26797284 2016 Adiponectin inhibits Wnt co-receptor, Lrp6, phosphorylation and ?-catenin signaling.
26387593 2015 Loss-of-Function Mutations in the WNT Co-receptor LRP6 Cause Autosomal-Dominant Oligodontia.
26239517 2015 miR-126 inhibits papillary thyroid carcinoma growth by targeting LRP6.
26120271 2015 Elevated LRP6 levels correlate with vascular endothelial growth factor in the vitreous of proliferative diabetic retinopathy.
26063413 2015 microRNA-513c suppresses the proliferation of human glioblastoma cells by repressing low-density lipoprotein receptor-related protein 6.
26031789 2015 Low density lipoprotein receptor related protein 1 and 6 gene variants and ischaemic stroke risk.
25959626 2015 Wnt co-receptor LRP5/6 overexpression confers protection against hydrogen peroxide-induced neurotoxicity and reduces tau phosphorylation in SH-SY5Y cells.
25902418 2015 LRP5/6 directly bind to Frizzled and prevent Frizzled-regulated tumour metastasis.
25783012 2015 Idiopathic Juvenile Osteoporosis: Clinical Experience from a Single Centre and Screening of LRP5 and LRP6 Genes.
25546815 2015 Rare LRP6 variants identified in spina bifida patients.
25500543 2015 Oncogenic KRAS signalling promotes the Wnt/?-catenin pathway through LRP6 in colorectal cancer.
25425204 2015 Sequence and structural difference favors a distinct preference of Wnt3a binding with co-receptor LRP6.
25358452 2015 Combined treatment with chrysin and 1,2,3,4,6-penta-O-galloyl-?-D-glucose synergistically inhibits LRP6 and Skp2 activation in triple-negative breast cancer and xenografts.
25301448 2015 Blocking of the interaction between Wnt proteins and their co-receptors contributes to the anti-tumor effects of adenovirus-mediated DKK3 in glioblastoma.
25242217 2014 Deficiency in LRP6-mediated Wnt signaling contributes to synaptic abnormalities and amyloid pathology in Alzheimer's disease.
25240815 2014 MiR-126-3p suppresses tumor metastasis and angiogenesis of hepatocellular carcinoma by targeting LRP6 and PIK3R2.
25143377 2014 Tyrosine-based signal mediates LRP6 receptor endocytosis and desensitization of Wnt/?-catenin pathway signaling.
24906453 2014 The LRP6 rs2302685 polymorphism is associated with increased risk of myocardial infarction.
24843317 2014 Low-density lipoprotein receptor-related protein 6 (LRP6) rs10845498 polymorphism is associated with a decreased risk of non-small cell lung cancer.
24743782 2014 Molecular simulation analysis of the structure complex of C2 domains of DKK family members and ?-propeller domains of LRP5/6: explaining why DKK3 does not bind to LRP5/6.
24704686 2014 miR-202 suppresses cell proliferation in human hepatocellular carcinoma by downregulating LRP6 post-transcriptionally.
24607787 2014 Rottlerin induces Wnt co-receptor LRP6 degradation and suppresses both Wnt/?-catenin and mTORC1 signaling in prostate and breast cancer cells.
24457908 2014 Fiber type-specific expression of low-density lipoprotein receptor-related protein 6 in human skeletal muscles.
24431302 2014 Wnt signaling in midbrain dopaminergic neuron development and regenerative medicine for Parkinson's disease.
24427284 2014 Functional analysis LRP6 novel mutations in patients with coronary artery disease.
24412065 2014 Multivesicular GSK3 sequestration upon Wnt signaling is controlled by p120-catenin/cadherin interaction with LRP5/6.
24392029 2013 Syndecan-1 (CD138) modulates triple-negative breast cancer stem cell properties via regulation of LRP-6 and IL-6-mediated STAT3 signaling.
24289859 2014 MicroRNA-183 suppresses retinoblastoma cell growth, invasion and migration by targeting LRP6.
24265322 2014 ?-arrestin promotes Wnt-induced low density lipoprotein receptor-related protein 6 (Lrp6) phosphorylation via increased membrane recruitment of Amer1 protein.
24203697 2014 Novel mutations in Lrp6 orthologs in mouse and human neural tube defects affect a highly dosage-sensitive Wnt non-canonical planar cell polarity pathway.
24115276 2014 The regulation and deregulation of Wnt signaling by PARK genes in health and disease.
23987510 2013 Lypd6 enhances Wnt/?-catenin signaling by promoting Lrp6 phosphorylation in raft plasma membrane domains.
23870195 2013 Genetics of coronary artery calcification among African Americans, a meta-analysis.
23811937 2013 MiR-126 promotes coxsackievirus replication by mediating cross-talk of ERK1/2 and Wnt/?-catenin signal pathways.
23773994 2013 LRP6 exerts non-canonical effects on Wnt signaling during neural tube closure.
23754096 2013 Effect of pantoprazole on human gastric adenocarcinoma SGC7901 cells through regulation of phospho?LRP6 expression in Wnt/?-catenin signaling.
23703864 2013 Rare nonconservative LRP6 mutations are associated with metabolic syndrome.
23666756 2013 Kallistatin antagonizes Wnt/?-catenin signaling and cancer cell motility via binding to low-density lipoprotein receptor-related protein 6.
23638027 2013 Anti-Sclerostin antibody inhibits internalization of Sclerostin and Sclerostin-mediated antagonism of Wnt/LRP6 signaling.
23395167 2013 LRP6 enhances glucose metabolism by promoting TCF7L2-dependent insulin receptor expression and IGF receptor stabilization in humans.
23306204 2013 SOX9 regulates low density lipoprotein receptor-related protein 6 (LRP6) and T-cell factor 4 (TCF4) expression and Wnt/?-catenin activation in breast cancer.
23302227 2013 Caveolin-1-LRP6 signaling module stimulates aerobic glycolysis in prostate cancer.
23218566 2013 A novel functional low-density lipoprotein receptor-related protein 6 gene alternative splice variant is associated with Alzheimer's disease.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23077088 2013 Abnormalities of the der(12)t(12;21) in ETV6-RUNX1 acute lymphoblastic leukemia.
22988876 2012 The importance of Wnt signalling for neurodegeneration in Parkinson's disease.
22907437 2013 ADP-ribosylation factors 1 and 6 regulate Wnt/?-catenin signaling via control of LRP6 phosphorylation.
22899650 2012 LRRK2 functions as a Wnt signaling scaffold, bridging cytosolic proteins and membrane-localized LRP6.
22871567 2012 LRP6 mediates Wnt/?-catenin signaling and regulates adipogenic differentiation in human mesenchymal stem cells.
22696217 2012 Characterization of the interaction of sclerostin with the low density lipoprotein receptor-related protein (LRP) family of Wnt co-receptors.
22606268 2012 A novel sLRP6E1E2 inhibits canonical Wnt signaling, epithelial-to-mesenchymal transition, and induces mitochondria-dependent apoptosis in lung cancer.
22589387 2012 The structural basis of DKK-mediated inhibition of Wnt/LRP signaling.
22575959 2012 ZNRF3 promotes Wnt receptor turnover in an R-spondin-sensitive manner.
22570728 2012 Upregulation of the Wnt co-receptor LRP6 promotes hepatocarcinogenesis and enhances cell invasion.
22491013 2012 Disabled-2 (Dab2) inhibits Wnt/?-catenin signalling by binding LRP6 and promoting its internalization through clathrin.
22490400 2012 Association of common polymorphisms in the LRP6 gene with sporadic coronary artery disease in a Chinese population.
22393312 2012 Association of a functional variant in the Wnt co-receptor LRP6 with early onset ileal Crohn's disease.
22372892 2011 Near-membrane ensemble elongation in the proline-rich LRP6 intracellular domain may explain the mysterious initiation of the Wnt signaling pathway.
22128165 2012 LRP6 protein regulates low density lipoprotein (LDL) receptor-mediated LDL uptake.
22000856 2011 Structural basis of Wnt signaling inhibition by Dickkopf binding to LRP5/6.
22000855 2011 Structural and functional studies of LRP6 ectodomain reveal a platform for Wnt signaling.
21984209 2011 Crystal structures of the extracellular domain of LRP6 and its complex with DKK1.
21944579 2011 Wnt antagonists bind through a short peptide to the first ?-propeller domain of LRP5/6.
21887268 2011 Dissecting molecular differences between Wnt coreceptors LRP5 and LRP6.
21536646 2011 Transmembrane protein 198 promotes LRP6 phosphorylation and Wnt signaling activation.
21471202 2011 Bone overgrowth-associated mutations in the LRP4 gene impair sclerostin facilitator function.
21397183 2011 Two structural and functional domains of MESD required for proper folding and trafficking of LRP5/6.
21304492 2011 Amer1/WTX couples Wnt-induced formation of PtdIns(4,5)P2 to LRP6 phosphorylation.
21245321 2011 Wild-type LRP6 inhibits, whereas atherosclerosis-linked LRP6R611C increases PDGF-dependent vascular smooth muscle cell proliferation.
20974802 2011 Mitogen-activated protein kinases promote WNT/beta-catenin signaling via phosphorylation of LRP6.
20926594 2011 Wnt receptors, bone mass, and fractures: gene-wide association analysis of LRP5 and LRP6 polymorphisms with replication.
20846389 2010 Differential expression of DKK-1 binding receptors on stromal cells and myeloma cells results in their distinct response to secreted DKK-1 in myeloma.
20676368 2010 Differential modulation of TCF/LEF-1 activity by the soluble LRP6-ICD.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20543981 2010 Dkk1 stabilizes Wnt co-receptor LRP6: implication for Wnt ligand-induced LRP6 down-regulation.
20460648 2010 Gbetagamma activates GSK3 to promote LRP6-mediated beta-catenin transcriptional activity.
20390408 2010 Analysis of three functional polymorphisms in relation to osteoporosis phenotypes: replication in a Spanish cohort.
20388731 2010 Stability elements in the LRP6 cytoplasmic tail confer efficient signalling upon DIX-dependent polymerization.
20351274 2010 Blocking the Wnt pathway, a unifying mechanism for an angiogenic inhibitor in the serine proteinase inhibitor family.
20194742 2010 LRP6 overexpression defines a class of breast cancer subtype and is a target for therapy.
20137080 2010 Helicobacter pylori-induced activation of beta-catenin involves low density lipoprotein receptor-related protein 6 and Dishevelled.
20093472 2010 Requirement of prorenin receptor and vacuolar H+-ATPase-mediated acidification for Wnt signaling.
20093360 2010 Reconstitution of a frizzled8.Wnt3a.LRP6 signaling complex reveals multiple Wnt and Dkk1 binding sites on LRP6.
20093106 2010 The low-density lipoprotein receptor-related protein 10 is a negative regulator of the canonical Wnt/beta-catenin signaling pathway.
20059949 2009 Cell cycle control of wnt receptor activation.
20057906 2009 Mutational screening of 10 genes in Chinese patients with microphthalmia and/or coloboma.
20053636 2010 LRP6 is internalized by Dkk1 to suppress its phosphorylation in the lipid raft and is recycled for reuse.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19898734 2009 Analysis of association of LRP5, LRP6, SOST, DKK1, and CTNNB1 genes with bone mineral density in a Slovenian population.
19881541 2010 Wnt signaling activation and mammary gland hyperplasia in MMTV-LRP6 transgenic mice: implication for breast cancer tumorigenesis.
19833493 2011 Carotid artery atherosclerosis in hypertensive patients with a functional LDL receptor-related protein 6 gene variant.
19801552 2009 G Protein-coupled receptor kinases phosphorylate LRP6 in the Wnt pathway.
19711366 2009 Phosphorylation of PPP(S/T)P motif of the free LRP6 intracellular domain is not required to activate the Wnt/beta-catenin pathway and attenuate GSK3beta activity.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19667113 2009 A common variant in low-density lipoprotein receptor-related protein 6 gene (LRP6) is associated with LDL-cholesterol.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19477926 2009 The first propeller domain of LRP6 regulates sensitivity to DKK1.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19339249 2009 Cooperative folding and ligand-binding properties of LRP6 beta-propeller domains.
19293931 2009 Inhibition of GSK3 phosphorylation of beta-catenin via phosphorylated PPPSPXS motifs of Wnt coreceptor LRP6.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19107203 2008 Direct inhibition of GSK3beta by the phosphorylated cytoplasmic domain of LRP6 in Wnt/beta-catenin signaling.
19015224 2009 Polymorphisms in C2, CFB and C3 are associated with progression to advanced age related macular degeneration associated with visual loss.
18981475 2008 Parathyroid hormone signaling through low-density lipoprotein-related protein 6.
18838381 2008 The pseudoreceptor BMP and activin membrane-bound inhibitor positively modulates Wnt/beta-catenin signaling.
18772438 2008 Wnt3a-mediated formation of phosphatidylinositol 4,5-bisphosphate regulates LRP6 phosphorylation.
18762581 2008 Caprin-2 enhances canonical Wnt signaling through regulating LRP5/6 phosphorylation.
18721193 2009 LRP5 in premature adrenarche and in metabolic characteristics of prepubertal children.
18717822 2008 Functional interactions between anthrax toxin receptors and the WNT signalling protein LRP6.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18606139 2008 Wnt3a and Dkk1 regulate distinct internalization pathways of LRP6 to tune the activation of beta-catenin signaling.
18524778 2008 Structural insight into the mechanisms of Wnt signaling antagonism by Dkk.
18505732 2008 DKK1 antagonizes Wnt signaling without promotion of LRP6 internalization and degradation.
18502762 2008 Characterization of the Kremen-binding site on Dkk1 and elucidation of the role of Kremen in Dkk-mediated Wnt antagonism.
18493104 2008 Lack of association of LRP5 and LRP6 polymorphisms with type 2 diabetes mellitus in the Japanese population.
18406176 2008 Radiographic osteoarthritis at three joint sites and FRZB, LRP5, and LRP6 polymorphisms in two population-based cohorts.
18378904 2008 Palmitoylation and ubiquitination regulate exit of the Wnt signaling protein LRP6 from the endoplasmic reticulum.
18362152 2008 Wnt signal amplification via activity, cooperativity, and regulation of multiple intracellular PPPSP motifs in the Wnt co-receptor LRP6.
18350154 2008 Evidence against a human cell-specific role for LRP6 in anthrax toxin entry.
18215320 2008 Ror2 modulates the canonical Wnt signaling in lung epithelial cells through cooperation with Fzd2.
18083125 2008 Multiple PPPS/TP motifs act in a combinatorial fashion to transduce Wnt signaling through LRP6.
18077588 2008 Initiation of Wnt signaling: control of Wnt coreceptor Lrp6 phosphorylation/activation via frizzled, dishevelled and axin functions.
17804805 2007 R-Spondin1 regulates Wnt signaling by inhibiting internalization of LRP6.
17765217 2007 Wise retained in the endoplasmic reticulum inhibits Wnt signaling by reducing cell surface LRP6.
17698587 2007 Analysis of endogenous LRP6 function reveals a novel feedback mechanism by which Wnt negatively regulates its receptor.
17569865 2007 Wnt induces LRP6 signalosomes and promotes dishevelled-dependent LRP6 phosphorylation.
17517621 2007 Common genetic variation within the low-density lipoprotein receptor-related protein 6 and late-onset Alzheimer's disease.
17400545 2007 R-spondin1 is a high affinity ligand for LRP6 and induces LRP6 phosphorylation and beta-catenin signaling.
17376403 2007 GRB10 binds to LRP6, the Wnt co-receptor and inhibits canonical Wnt signaling pathway.
17332414 2007 LRP6 mutation in a family with early coronary disease and metabolic risk factors.
17326769 2007 Regulated proteolytic processing of LRP6 results in release of its intracellular domain.
17239604 2007 The vacuolar-ATPase inhibitor bafilomycin and mutant VPS35 inhibit canonical Wnt signaling.
16989816 2006 Modulation of LRP6-mediated Wnt signaling by molecular chaperone Mesd.
16890161 2006 Caveolin is necessary for Wnt-3a-dependent internalization of LRP6 and accumulation of beta-catenin.
16815997 2006 The role of microtubule actin cross-linking factor 1 (MACF1) in the Wnt signaling pathway.
16564009 2006 The LDL receptor-related protein LRP6 mediates internalization and lethality of anthrax toxin.
16543246 2006 Mouse cristin/R-spondin family proteins are novel ligands for the Frizzled 8 and LRP6 receptors and activate beta-catenin-dependent gene expression.
16541075 2006 The finished DNA sequence of human chromosome 12.
16513652 2006 Negative regulation of LRP6 function by casein kinase I epsilon phosphorylation.
16384981 2006 Functional candidate genes in age-related macular degeneration: significant association with VEGF, VLDLR, and LRP6.
16365045 2006 The low density lipoprotein receptor-related protein 6 interacts with glycogen synthase kinase 3 and attenuates activity.
16355283 2006 Common genetic variation of the low-density lipoprotein receptor-related protein 5 and 6 genes determines fracture risk in elderly white men.
16341017 2005 A dual-kinase mechanism for Wnt co-receptor phosphorylation and activation.
16263759 2005 Mesd binds to mature LDL-receptor-related protein-6 and antagonizes ligand binding.
15908424 2005 SOST is a ligand for LRP5/LRP6 and a Wnt signaling inhibitor.
15778503 2005 Sclerostin binds to LRP5/6 and antagonizes canonical Wnt signaling.
15516984 2004 LRP6 expression promotes cancer cell proliferation and tumorigenesis by altering beta-catenin subcellular distribution.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15469977 2004 Skeletal defects in ringelschwanz mutant mice reveal that Lrp6 is required for proper somitogenesis and osteogenesis.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15271658 2004 LDL receptor-related protein LRP6 regulates proliferation and survival through the Wnt cascade in vascular smooth muscle cells.
15084453 2004 LDL receptor-related proteins 5 and 6 in Wnt/beta-catenin signaling: arrows point the way.
14739301 2004 The low density lipoprotein receptor-1, LRP1, interacts with the human frizzled-1 (HFz1) and down-regulates the canonical Wnt signaling pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12897152 2003 A novel mechanism for Wnt activation of canonical signaling through the LRP6 receptor.
12857724 2003 Functional characterization of WNT7A signaling in PC12 cells: interaction with A FZD5 x LRP6 receptor complex and modulation by Dickkopf proteins.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12121999 2002 A novel set of Wnt-Frizzled fusion proteins identifies receptor components that activate beta -catenin-dependent signaling.
11742004 2002 Second cysteine-rich domain of Dickkopf-2 activates canonical Wnt signaling pathway via LRP-6 independently of dishevelled.
11448771 2001 Head inducer Dickkopf-1 is a ligand for Wnt coreceptor LRP6.
11433302 2001 Novel mechanism of Wnt signalling inhibition mediated by Dickkopf-1 interaction with LRP6/Arrow.
11357136 2001 LDL-receptor-related protein 6 is a receptor for Dickkopf proteins.
11029007 2000 LDL-receptor-related proteins in Wnt signal transduction.
10036184 1999 A physical, transcript, and deletion map of chromosome region 12p12.3 flanked by ETV6 and CDKN1B: hypermethylation of the LRP6 CpG island in two leukemia patients with hemizygous del(12p).
9704021 1998 Isolation and characterization of LRP6, a novel member of the low density lipoprotein receptor gene family.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.