Property Summary

NCBI Gene PubMed Count 217
PubMed Score 1201.98
PubTator Score 434.76

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (9)

Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Osteoporosis 259 5.73 2.9
Disease Target Count Z-score Confidence
Osteogenesis imperfecta 34 4.214 2.1
Osteopetrosis 40 3.998 2.0

Expression

  Differential Expression (15)

Disease log2 FC p
psoriasis -2.100 3.5e-05
oligodendroglioma 1.100 7.5e-14
osteosarcoma -1.426 6.3e-03
atypical teratoid / rhabdoid tumor 1.700 4.8e-05
glioblastoma 1.800 2.0e-04
sonic hedgehog group medulloblastoma 1.400 6.2e-04
medulloblastoma, large-cell 1.300 2.4e-03
primitive neuroectodermal tumor 1.900 3.6e-05
adrenocortical carcinoma -1.211 7.6e-03
interstitial cystitis -1.600 1.3e-03
pediatric high grade glioma 1.300 4.2e-04
pilocytic astrocytoma 1.100 1.1e-03
ductal carcinoma in situ -1.400 1.4e-03
invasive ductal carcinoma -1.200 2.4e-02
pituitary cancer -1.600 6.7e-07

 CSPA Cell Line (4)

Protein-protein Interaction (2)

Gene RIF (216)

PMID Text
26739212 LRP5 is a novel anti-inflammatory macrophage marker that positively regulates migration, phagocytosis, lipid uptake and metabolism.
26711269 Lrp5 controls glucose uptake and growth of MDA-MB-231 human breast cancer cells.
26681532 Data show that LDL receptor-related protein 5 (LRP5) gain-of-function mutations do not activate beta-catenin signaling in osteoblasts.
26666179 LRP5 is a signature of the anti-inflammatory defensive phenotype of macrophages.
26248735 No LRP5 variant was found to be associated with type 2 diabetes mellitus in Han Chinese, but haplotype TT was found to be associated with type 2 diabetes mellitus .
26244290 Among the patients with pathogenic mutations detected, FZD4 mutations accounted for the largest proportion of autosomal inheritance FEVR cases (13/18 patients, 72.2%), followed by LRP5 (4/18 patients, 22.2%) and TSPAN12 (1/18 patients, 5.6%).
26117992 mechanism of LRP protein action in the process of bone tissue metabolism and etiology of osteoporosis.
25959626 findings suggest that rescuing LRP5/6-mediated Wnt signaling improves neuronal cell survival and reduces tau phosphorylation, which support the hypothesis that Wnt signaling might be an attractive therapeutic strategy for managing AD
25945592 Molecular testing identified biallelic lipoprotein receptor-related protein 5 (LRP5) mutations (NM_002335.3:c. [889dupA]; [2827 + 1G > A]) confirming a diagnosis of osteoporosis-pseudoglioma (OPPG) syndrome.
25920554 we identified a total of four different LRP5 variants that were predicted to be pathogenic by in silico tools. One ADPKD patient has a positive family history for ADPKD and variant LRP5 segregated with the disease.
25902418 Lrp5 binds to Frizzled, preventing Frz-regulated non-canonical Wnt pathway activation and further non-canonical pathway-mediated tumour metastasis.
25863010 no association of single nucleotide polymorphisms and type 2 diabetes mellitus susceptibility in Chinese population
25783012 No mutations in LRP5 and LRP6 could be identified
25762437 finding corroborates the relationship between LRP5 genotype and bone phenotype in postmenopausal women, however, the complete mechanism of this relationship requires further investigations.
25651180 Reciprocally, a low bone mineral density-associated common LRP5 allele correlated with increased abdominal adiposity.
25580429 These results suggest that there is a modest effect of the LRP5 rs3736228 C>T on the increased susceptibility of bone fracture and osteoporosis.
25515155 This study show LRP5 polymorphism may associate with body composition and bone mineral density in Iranian children.
25392953 This is the first study to suggest the genetic influence of LRP5 A1330V polymorphism on bone mineral density in COPD patients, independent of the development of emphysema.
25384351 Although AFFs have been reported in other rare bone diseases, this is the first in a genetic condition of primary osteoblast dysfunction. The relatively low bone turnover observed, and knowledge of LRP5 function
24927689 Serum levels of Wnt inhibitors are not changed in individuals with high bone mass causing mutations in LRP5.
24921217 The Wnt coreceptor, Lrp5, is a genetic driver of lung fibrosis in mice and a marker of disease progression and severity in humans with idiopathic pulmonary fibrosis.
24897288 The A1330V polymorphism of LRP5 is possibly correlated with response to alendronate treatment in Chinese women.
24885293 The Ala1330Val polymorphism in LRP5 is weakly associated with lower lumbar spine bone density in Tunisian post-menopausal women.
24743782 The results suggested that the lack of affinity between human DKK3 and human LRP5/6 results from: i) insertion of the 7 amino acids, and ii) P258 in human DKK3.
24736728 evidence of lack of LRP5 mutations and of a putative HBM-causing mutation in DKK1
24715757 Two new novel LRP5 mutations in Chinese patients with familial exudative vitreoretinopathy and mild reduced bone mineral density, were identified.
24706814 Functional activity analyses indicated that mutant LRP5 led to reduced wingless signal activation
24606091 Circulating plasma sclerostin concentrations are increased in both LRP5 and non-LRP5 High bone mass patients compared with controls.
24479426 Our findings indicate that LRP5 plays an essential role in osteoarthritis cartilage destruction
24412065 GSK3 is sequestered into multivesicular bodies through and interaction between p120-catenin/cadherin and LRP5/6.
24403228 LRP5 plays a role in prostate cancer invasion growth and skeletal metastasis in vitro and in vivo.
24376863 LRP5 polymorphisms may be modestly associated with bone mineral density of the lumbar spine and the femur neck.
24337955 These results underscore the significance of the LRP5 gene in bone metabolism and emphasize the significance of the replication of previous results in independent cohorts.
24266894 LRP5 negatively regulates differentiation of monocytes through abrogation of Wnt signaling.
24130145 The Val genotype of the rs3736228 (p.A1330V) of LRP5 was significantly associated with bone mineral density (BMD) variations at the lumbar spine, total hip, and femoral neck. None of the three polymorphisms of TNFRSF11B was associated with BMD variations.
23800666 Studies indicate that splice site mutation that leads to aberrant splicing often causes genetic skeletal system disease, like COL1A1, SEDL and LRP.
23490293 Identify rs4988300 and rs3781590 LPR5 polymorphisms as independent genetic markers of abdominal aortic aneurysms.
23441120 Six different nonsynonymous DNA variants in are identified in the coding region of either the FZD4 gene (p.H69Y, p.R127H, and p.Y211H) or the LRP5 gene (p.R1219H, p.H1383P, and p.T1540M) in seven patients with advanced retinopathy of prematurity
23318847 In this osteosclerotic Chinese family, the A242T mutation in the LRP5 gene results in a high bone mass phenotype with an elongated mandible and torus palatinus in the center of the hard palate.
23242660 Our results supported the association of LRP5 with osteoporosis and showed the potential value of LRP5 haplotypes to identify risk of osteoporosis in Mexican population.
23238007 LRP5 and FDPS loci age-specifically affect skeletal traits in healthy fertile women.
23077402 Six mutations have been found in the LRP5 gene in five Chinese families with familial exudative vitreoretinopathy.
23054017 Demonstration of the additive effect of four polymorphisms on the LRP5, LEPR, near MC4R and SH2B1 genes on metabolic syndrome risk.
23041840 Six Dkk-1, three Sost, one Kremen-1 and 10 LRP-5 polymorhpisms were significantly associated with radiological progression of rheumatoid arthritis joint destruction.
22848540 LRP5-Tie2-Ang signaling axis plays a central role in control of both angiogenesis and alveolarization during postnatal lung development
22696217 peptide derived from the loop 2 region of sclerostin blocked the interaction of sclerostin with LRP5/6 and also inhibited Wnt1 but not Wnt3A or Wnt9B signaling. This suggests that these Wnts interact with LRP6 in different ways
22589387 Crystal structures of the LRP6 ectodomain in complex with DKK1, along with mutagenesis studies, provide considerable insights into the molecular basis for DKK-mediated inhibition and Wnt signaling through LRP5/6
22513174 Wnt/beta-catenin signaling activation through LRP-5 may contribute to chondrocyte hypertrophy and cartilage degradation in osteoarthritis.
22487062 Two novel LRP5 mutations (c.3446 T > A; p.L1149Q and c.3553 G > A; p.G1185R) were identified in two patients and their affected family members.
22303459 LRP5 oligomerization results in its localization to disheveled-containing punctate structures and sequestration of scaffold protein Axin, leading to robust beta-catenin-mediated signaling.
22207519 osteosarcoma patients whose primary tumors expressed LRP-5 sustained a higher risk of developing metastasis
22167346 These results suggest that LRP5 alleles influence the type of hip fractures
22000856 The LRP5 is a coreceptor for Wnt growth factors, and also bind Dkk proteins, secreted inhibitors of Wnt signaling.
21887268 These studies uncover a new and important molecular tuning mechanism for differential regulation of LRP5 and LRP6 phosphorylation and signaling activity.
21885484 Data suggest that LRP5 may be involved in the pathogenesis of ankylosing spondylitis.
21840657 These findings demonstrate that the A1330V and V667M polymorphisms are associated with low bone mineral density in peri- and postmenopausal Greek women.
21821287 LRP5 gene rearrangement in 11q13.2 is associated with acute myeloid leukemia.
21774378 SNP (IVS17-1677C>A) located in intron 17 of LRP5 has effects on bone density of postmenopausal Japanese women.[review]
21542013 This is the first time that the direct action of RUNX2 on LRP5 has been described.
21528003 The LRP5.Q89R polymorphism did not change protein expression, interaction with the molecular chaperone MESD, protein trafficking, Wnt signaling transduction, or its efficacy in DKK1-mediated inhibition.
21471826 The LRP5 c.266A > G and c.3893C > T polymorphisms may be associated with risk of nonresponse to hormone therapy in postmenopausal Korean women.
21432225 Analysis of variance and post hoc Tukey test indicated that mean bone mass density was significantly lower in subjects with VV genotype than in those with AA genotype (0.540 +/- 0.048 versus 0.562 +/- 0.062 g/cm(2)).
21407258 Study present clinical and genetic data for four Osteoporosis-pseudoglioma sydrome patients with novel LRP5 mutations, three of which affect splicing
21397183 Two structural and functional domains of MESD required for proper folding and trafficking of LRP5/LRP6.
21351148 Increased bone mass in Lrp5-high bone mass patients seems to be caused primarily by changes in trabecular and cortical bone mass and structure.
21147715 LRP5 gene was stronly associated with the BMD in Europeans and North Americans.
21116122 association of Ala1330Val and Val667Met polymorphisms in LRP5 with volumetric BMD and macro-architectural bone parameters in a population-based sample of men and women
20961463 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20960157 Observational study of gene-disease association. (HuGE Navigator)
20953208 Common polymorphic variations of the LRP5 gene do not influence peak bone mass acquisition and obesity phenotypes in young Chinese men.
20953208 Observational study of gene-disease association. (HuGE Navigator)
20926594 We found common polymorphisms of LRP5 associated with osteoporotic fractures, and polymorphisms of the LRP6 gene associated with BMD, thus suggesting them as likely candidates to contribute to the explaination of the hereditary influence on osteoporosis.
20926594 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20846389 The mRNA expression levels of DKK-1 binding receptor LRP5/6 and Krm1/2 in SCs from patients with MM were significantly higher than those in myeloma cells and in SCs from healthy donors.
20630166 These findings demonstrate that both LRP5 polymorphism and its interaction with calcium intake are associated with BMD, whereas higher calcium intake was shown to decrease the negative effect of this polymorphism on BMD
20630166 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20613673 Observational study of gene-disease association. (HuGE Navigator)
20554715 Observational study of gene-disease association. (HuGE Navigator)
20534768 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
20200978 Observational study of gene-disease association. (HuGE Navigator)
20200960 circulating serotonin levels mediate the increased bone mass resulting from gain-of-function mutations in Lrp5 in humans
20198315 Observational study of gene-disease association. (HuGE Navigator)
20146170 Evidence of an allele of LRP5 in Chinese increases the total cholesterol level in a general Han population.
20146170 Observational study of gene-disease association. (HuGE Navigator)
20141633 Both Kruppel-like factor 15 and specificity protein 1 binding motifs are essential for human LRP5 promoter activity.
20101398 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20045498 Our study shows that in children LRP5 mutations are not a common cause of increased fractures.
20045498 Observational study of gene-disease association. (HuGE Navigator)
20034086 found various types of LRP5 mutations, including an exon-level deletion that is undetectable by standard PCR-based mutation screening. Oligonucleotide tiling microarray seems to be a powerful tool in identifying cryptic structural mutations
19948975 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19898734 results suggest that A1330V in LRP5, is not associated with bone mineral density in the Slovenian population
19898734 Observational study of gene-disease association. (HuGE Navigator)
19851296 Observational study of gene-disease association. (HuGE Navigator)
19810105 Catabolic role of LRP5 may be mediated by Wnt/beta-catenin pathway in human osteoarthritis.
19789208 Increased LRP5 polymorphisms may contribute to bone mass accrual in prepubertal premeture adrenarche children.
19746449 a high bone mass mutant LRP5(G171V), has subtly reduced Dkk1 binding, and, in contrast to LRP5, no enhancement of binding with MesD
19692168 Observational study of gene-disease association. (HuGE Navigator)
19673927 We found high prevalence of osteoporosis and abnormal glucose metabolism in subjects with LRP5 mutation(s).
19673927 Observational study of gene-disease association. (HuGE Navigator)
19629617 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19571442 association between the A1330V SNP and total body BMD were replicated in 739 postmenopausal Japanese women (AA vs. VV; P = 0.0026). These data suggest that the V1330 variant in the LRP5 gene decreases Wnt activity, which in turn decreases the BMD.
19506792 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19453261 Observational study of gene-disease association. (HuGE Navigator)
19336475 Observational study of gene-disease association. (HuGE Navigator)
19233690 Gene Ontology analysis indicated a significant alteration of oxygen transport (increased hemoglobin gene expression) and lipid metabolism [including monoglyceride lipase and low density lipoprotein receptor-related protein 5 (LRP5) gene].
19225709 The geometric dimensions of the proximal femur in perimenopausal women are not associated with LRP5 polymorphism.
19225709 Observational study of gene-disease association. (HuGE Navigator)
19177549 identifying two novel types of mutation in related individuals whose presenting features were profound muscle hypotonia, mild mental retardation, blindness, and growth retardation
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19158955 the LRP5Delta receptor is strongly implicated in mammary gland tumorigenesis
19148563 the LRP5 A1330V polymorphism is associated with hip bone mineral density in osteoporotic men, but allelic variations in LRP5 do not appear to be associated with response to bisphosphonate treatment.
19148563 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19147944 This review finds that LRP5 and LRP6 play overlapping roles in both early and late stages of osteoblast differentiation.
19107203 Phosphorylated LRP6/5 both recruits and directly inhibits GSK3beta using two distinct portions of its cytoplasmic sequence.
19023643 results suggest that the LPR5 polymorphism does not appear to be a clinically useful marker for the prediction of fracture risk in Japanese female rheumatoid arthritis patients, although it is associated with increased serum total cholesterol levels.
19023643 Observational study of gene-disease association. (HuGE Navigator)
18932002 This meta-analysis shows that LRP5 A1330V polymorphism is associated with bone density, and that individuals with the AA genotype have a higher bone density than those with the AV/VV or VV genotype.
18932002 Meta-analysis of gene-disease association. (HuGE Navigator)
18825883 Follow-up of pamidronate therapy in two brothers with osteoporosis-pseudoglioma syndrome (OPPG) carrying an LRP5 mutation.
18721193 Genetic variation in LRP5 did not predispose to premature adrenarche but was associated with metabolic characteristics, especially lipid profile, in healthy prepubertal children.
18721193 Observational study of gene-disease association. (HuGE Navigator)
18684085 analysis of LRP5 haplotypes in relation to osteoporosis phenotypes in Spanish postmenopausal women
18684085 Observational study of gene-disease association. (HuGE Navigator)
18676680 Observational study of gene-disease association. (HuGE Navigator)
18588671 there is a modest effect of the A1330V polymorphism on BMD in the general population, and that the modest association may limit its clinical use
18588671 Meta-analysis of gene-disease association. (HuGE Navigator)
18524778 analysis of the structural basis of the interaction between Dkk and low density lipoprotein receptor-related protein (LRP) 5/6
18521528 DKK1 and sclerostin are independent, and not synergistic, regulators of LRP5 signaling and that the function of each is impaired by HBM-LRP5 mutations
18502762 Kremen may not be essential for Dkk1-mediated Wnt antagonism and Kremen may only play a role when cells express a high level of LRP5/6
18493104 We found no evidence for a substantial effect of LRP5 or LRP6 SNPs on susceptibility to type 2 diabetes or clinical characteristics of diabetic subjects in Japanese population.
18493104 Observational study of gene-disease association. (HuGE Navigator)
18455228 Two gene variants of key biological proteins increase the risk of osteoporosis and osteoporotic fracture.
18455228 Genome-wide association study of gene-disease association. (HuGE Navigator)
18418639 The association between LRP5 V667M and LS BMD is confirmed but not that between ESRRA repeats and LS BMD.
18418639 Observational study of gene-disease association. (HuGE Navigator)
18406176 No association was seen between FRZB, LRP5 and LRP6 variants with radiographic osteoarthritic outcomes in two population-based cohorts
18406176 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
18349089 LRP5 may be the first gene to reach a genome-wide significance level for a phenotype related to osteoporosis.
18349089 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
18285546 Observational study of gene-disease association. (HuGE Navigator)
18073493 Observational study of gene-disease association. (HuGE Navigator)
18073493 Single nucleotide polymorphisms of the LRP5 promoter are associated with bone mineral density variation in young Chinese females
18058054 The Ala1330Val and Val667Met polymorphisms in the low-density lipoprotein receptor-related protein 5 gene are significantly associated with peak bone mass in physically active men.
18058054 Observational study of gene-disease association. (HuGE Navigator)
18044981 an internally truncated LRP5 receptor is strongly implicated in deregulated activation of the WNT/beta-catenin signaling pathway in hyperparathyroid tumors
18026682 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
17972053 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17953969 Observational study of gene-disease association. (HuGE Navigator)
17700537 concludes that bone-derived prostate cell line that produces osteoblastic lesions induces new bone formation through Wnt canonical signaling, that LRP5 mediates this effect, and that DKK1 is involved in the balance between bone formation and resorption
17680723 LRP5 mutations and the level of Wnt signaling determine differentiation fate of hMSCs into osteoblasts or adipocytes.
17505772 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17505772 LRP5 polymorphism effect on bone mineral density is apparent in childhood
17307038 Observational study of gene-disease association. (HuGE Navigator)
17307038 Premenopausal women drove the association as expected from the proposed role of LRP5 in peak bone mass
17306638 Observational study of gene-disease association. (HuGE Navigator)
17306638 genetic variations in LRP5 are important factors affecting BMD in adult women, and 1330 V may contribute to osteoporosis susceptibility, at least in Japanese
17276019 Results indicate the importance of LRP5 beta-propeller 1 for Dkk1 function and Wnt signaling.
17241106 Observational study of gene-disease association. (HuGE Navigator)
17229572 1,25(OH)(2)D(3) can enhance the expression of a critical component of the Wnt signaling pathway which is known to impact osteogenesis
17223614 In comparison with subjects with the AlaAla genotype (n=215), those with AlaVal genotype (n=20) had lower femoral neck BMC (P=0.029) and BMD (P=0.012), trochanter BMC (P=0.0067) and BMD (P=0.015), and total hip BMC (P=0.0044) and BMD (P=0.0089).
17202888 Observational study of gene-disease association. (HuGE Navigator)
17137849 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17137849 Wnt-LRP5 signalling may play a role in the adaptation of bone to mechanical load in humans, and may explain some gender-related differences in bone mass
17087607 we found a relationship between the LRP5 genotype and serum follicle stimulating hormone but not luteinizing hormone levels
17087607 Observational study of gene-disease association. (HuGE Navigator)
17086708 Observational study of gene-disease association. (HuGE Navigator)
17052975 SOST-LRP5 antagonistic interaction plays a central role in bone mass regulation and may represent a nodal point for therapeutic intervention for osteoporosis and other bone diseases
17002572 functional interactions between Sost or Wise and LRP5 have the potential to regulate bone deposition by modulating Wnt signaling
16958596 Observational study of gene-disease association. (HuGE Navigator)
16956801 This study examined human LRP5 signaling and the effects of an intracellular domain single nucleotide polymorphism (SNP: p.V1525A) on osteoblast differentiation and mineralization.
16772034 Splice forms of crucial genes of the Wnt-pathway, beta-Catenin, LRP5, GSK3beta, Axin-1 and CtBP1 are expressed in human colorectal tissue.
16754270 Observational study of gene-disease association. (HuGE Navigator)
16754270 The Q89R polymorphism is an independent factor for hypertension in Japanese females.
16723389 Observational study of gene-disease association. (HuGE Navigator)
16679074 observed mutations may affect the molecular interactions of LRP5 and so lead to the observed osteoporosis pseudoglioma syndrome phenotypes
16631011 LRP5 was increased in the calcified aortic valves by protein and gene expression.
16622736 Observational study of gene-disease association. (HuGE Navigator)
16613987 Lrp5 locus was discovered to confer vitamin D response to a heterologous promoter when introduced into osteoblastic cells
16513652 active CKIepsilon generation may induce a negative feedback loop by phosphorylation of sites on LRP5/6 that modulate axin binding and hence beta-catenin degradation
16355283 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16234968 Carrying an LRP5 mutation is a risk factor for idiopathic osteoporosis, but idiopathic osteoporosis in men is infrequently underlied by such a mutation.
16168727 Observational study of gene-disease association. (HuGE Navigator)
16168727 These data indicate an association between LRP5 variants and idiopathic osteoporosis in males, pointing to a role of LRP5 in this disease.
16115379 Observational study of gene-disease association. (HuGE Navigator)
15981244 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15981244 mutations in the LRP5 and/or FZD4 genes may have roles in familial exudative vitreoretinopathy
15979013 Observational study of gene-disease association. (HuGE Navigator)
15923613 These data suggest that HBM mutant proteins can transit to the cell surface in sufficient quantity to transduce Wnt signal and that the likely mechanism for the HBM mutations' physiologic effects is via reduced affinity to and inhibition by DKK1.
15908424 SOST antagonizes Wnt signaling by binding to the extracellular domain of the Wnt coreceptors LRP5 and LRP6 and disrupting Wnt-induced Frizzled-LRP complex formation.
15824861 a novel LRP5 mutation may be responsible for oropharyngeal skeletal disease
15824851 heterozygous mutations in the LRP5 gene can cause osteoporosis in both children and adults
15781005 Observational study of gene-disease association. (HuGE Navigator)
15777745 Observational study of gene-disease association. (HuGE Navigator)
15777745 genetic variation in LRP5 seems to be of importance for regulation of bone mass and osteoporotic fractures
15619672 Observational study of gene-disease association. (HuGE Navigator)
15355556 Observational study of gene-disease association. (HuGE Navigator)
15346351 Mutations in LRP5 can cause autosomal recessive or dominant Familial exudative vitreoretinopathy.
15221492 Observational study of gene-disease association. (HuGE Navigator)
15221492 LRP5 gene is a candidate for the genetic determinants of bone mineral density in postmenopausal women
15201508 Observational study of gene-disease association. (HuGE Navigator)
15201508 no association was found between a LRP5 polymorphism and peak bone mass in young men
15077203 Observational study of gene-disease association. (HuGE Navigator)
15024691 Familial exudative vitreoretinopathy has mutations in a second gene at the EVR1 locus, low-density-lipoprotein receptor-related protein 5 (LRP5), a Wnt coreceptor
14735475 LRP5 has a role in neoplasm metastasis
14727154 Observational study of gene-disease association. (HuGE Navigator)
14727154 LRP5 is a bone mineral density determinant and also contributes to a risk of osteoporosis
12817748 G171V transgenic mice showed an increase in actively mineralizing bone surface and enhanced alkaline phosphatase staining in osteoblasts
12700977 disease association data, largely focused in the LRP5 region with 1,106 type 1 diabetes families, provided no further evidence for disease association at LRP5 or at D11S987
12579474 Six novel missense mutations in this gene shown in various conditions with an increased bone density and bone diseases.
12054167 localization to chromosome 11q12-13 in autosomal dominant osteopetrosis type I
12015390 The LRP5V171 mutation causes high bone density by impairing the action of a normal antagonist of the Wnt pathway and thus increasing Wnt signaling. These findings demonstrate the role of altered LRP5 function in high bone mass.
11793484 seven novel sequence variants/polymorphisms
11741193 mutation results in an autosomal dominant high-bone-mass trait

AA Sequence

MEAAPPGPPWPLLLLLLLLLALCGCPAPAAASPLLLFANRRDVRLVDAGGVKLESTIVVSGLEDAAAVDF      1 - 70
QFSKGAVYWTDVSEEAIKQTYLNQTGAAVQNVVISGLVSPDGLACDWVGKKLYWTDSETNRIEVANLNGT     71 - 140
SRKVLFWQDLDQPRAIALDPAHGYMYWTDWGETPRIERAGMDGSTRKIIVDSDIYWPNGLTIDLEEQKLY    141 - 210
WADAKLSFIHRANLDGSFRQKVVEGSLTHPFALTLSGDTLYWTDWQTRSIHACNKRTGGKRKEILSALYS    211 - 280
PMDIQVLSQERQPFFHTRCEEDNGGCSHLCLLSPSEPFYTCACPTGVQLQDNGRTCKAGAEEVLLLARRT    281 - 350
DLRRISLDTPDFTDIVLQVDDIRHAIAIDYDPLEGYVYWTDDEVRAIRRAYLDGSGAQTLVNTEINDPDG    351 - 420
IAVDWVARNLYWTDTGTDRIEVTRLNGTSRKILVSEDLDEPRAIALHPVMGLMYWTDWGENPKIECANLD    421 - 490
GQERRVLVNASLGWPNGLALDLQEGKLYWGDAKTDKIEVINVDGTKRRTLLEDKLPHIFGFTLLGDFIYW    491 - 560
TDWQRRSIERVHKVKASRDVIIDQLPDLMGLKAVNVAKVVGTNPCADRNGGCSHLCFFTPHATRCGCPIG    561 - 630
LELLSDMKTCIVPEAFLVFTSRAAIHRISLETNNNDVAIPLTGVKEASALDFDVSNNHIYWTDVSLKTIS    631 - 700
RAFMNGSSVEHVVEFGLDYPEGMAVDWMGKNLYWADTGTNRIEVARLDGQFRQVLVWRDLDNPRSLALDP    701 - 770
TKGYIYWTEWGGKPRIVRAFMDGTNCMTLVDKVGRANDLTIDYADQRLYWTDLDTNMIESSNMLGQERVV    771 - 840
IADDLPHPFGLTQYSDYIYWTDWNLHSIERADKTSGRNRTLIQGHLDFVMDILVFHSSRQDGLNDCMHNN    841 - 910
GQCGQLCLAIPGGHRCGCASHYTLDPSSRNCSPPTTFLLFSQKSAISRMIPDDQHSPDLILPLHGLRNVK    911 - 980
AIDYDPLDKFIYWVDGRQNIKRAKDDGTQPFVLTSLSQGQNPDRQPHDLSIDIYSRTLFWTCEATNTINV    981 - 1050
HRLSGEAMGVVLRGDRDKPRAIVVNAERGYLYFTNMQDRAAKIERAALDGTEREVLFTTGLIRPVALVVD   1051 - 1120
NTLGKLFWVDADLKRIESCDLSGANRLTLEDANIVQPLGLTILGKHLYWIDRQQQMIERVEKTTGDKRTR   1121 - 1190
IQGRVAHLTGIHAVEEVSLEEFSAHPCARDNGGCSHICIAKGDGTPRCSCPVHLVLLQNLLTCGEPPTCS   1191 - 1260
PDQFACATGEIDCIPGAWRCDGFPECDDQSDEEGCPVCSAAQFPCARGQCVDLRLRCDGEADCQDRSDEA   1261 - 1330
DCDAICLPNQFRCASGQCVLIKQQCDSFPDCIDGSDELMCEITKPPSDDSPAHSSAIGPVIGIILSLFVM   1331 - 1400
GGVYFVCQRVVCQRYAGANGPFPHEYVSGTPHVPLNFIAPGGSQHGPFTGIACGKSMMSSVSLMGGRGGV   1401 - 1470
PLYDRNHVTGASSSSSSSTKATLYPPILNPPPSPATDPSLYNMDMFYSSNIPATARPYRPYIIRGMAPPT   1471 - 1540
TPCSTDVCDSDYSASRWKASKYYLDLNSDSDPYPPPPTPHSQYLSAEDSCPPSPATERSYFHLFPPPPSP   1541 - 1610
CTDSS                                                                    1611 - 1615
//

Text Mined References (232)

PMID Year Title
27228167 2016 Whole Exome Sequencing Analysis Identifies Mutations in LRP5 in Indian Families with Familial Exudative Vitreoretinopathy.
26739212 2016 LRP5: A novel anti-inflammatory macrophage marker that positively regulates migration and phagocytosis.
26711269 2015 Lrp5 Has a Wnt-Independent Role in Glucose Uptake and Growth for Mammary Epithelial Cells.
26681532 2016 Normal hematopoiesis and lack of ?-catenin activation in osteoblasts of patients and mice harboring Lrp5 gain-of-function mutations.
26666179 2016 LRP5 associates with specific subsets of macrophages: Molecular and functional effects.
26248735 2015 Association between Low-density Lipoprotein Receptor-related Protein 5 Polymorphisms and Type 2 Diabetes Mellitus in Han Chinese: a Case-control Study.
26244290 2015 Molecular Characterization of FZD4, LRP5, and TSPAN12 in Familial Exudative Vitreoretinopathy.
26117992 2015 [The role of Wnt/?-catenin pathway and LRP5 protein in metabolism of bone tissue and osteoporosis etiology].
25959626 2015 Wnt co-receptor LRP5/6 overexpression confers protection against hydrogen peroxide-induced neurotoxicity and reduces tau phosphorylation in SH-SY5Y cells.
25945592 2015 Congenital Bilateral Retinal Detachment in Two Siblings with Osteoporosis-Pseudoglioma Syndrome.
25920554 2016 LRP5 variants may contribute to ADPKD.
25902418 2015 LRP5/6 directly bind to Frizzled and prevent Frizzled-regulated tumour metastasis.
25863010 2015 Association of LRP5, TCF7L2, and GCG variants and type 2 diabetes mellitus as well as fasting plasma glucose and lipid metabolism indexes.
25783012 2015 Idiopathic Juvenile Osteoporosis: Clinical Experience from a Single Centre and Screening of LRP5 and LRP6 Genes.
25762437 2016 Strong effect of SNP rs4988300 of the LRP5 gene on bone phenotype of Caucasian postmenopausal women.
25651180 2015 LRP5 regulates human body fat distribution by modulating adipose progenitor biology in a dose- and depot-specific fashion.
25580429 2014 Common polymorphism in the LRP5 gene may increase the risk of bone fracture and osteoporosis.
25515155 2015 The impact of LRP5 polymorphism (rs556442) on calcium homeostasis, bone mineral density, and body composition in Iranian children.
25392953 2015 Polymorphism of LRP5 gene and emphysema severity are associated with osteoporosis in Japanese patients with or at risk for COPD.
25384351 2015 Atypical femoral fracture in osteoporosis pseudoglioma syndrome associated with two novel compound heterozygous mutations in LRP5.
24945404 2014 Phenotypic dissection of bone mineral density reveals skeletal site specificity and facilitates the identification of novel loci in the genetic regulation of bone mass attainment.
24927689 2014 Serum levels of sclerostin, Dickkopf-1, and secreted frizzled-related protein-4 are not changed in individuals with high bone mass causing mutations in LRP5.
24921217 2014 Wnt coreceptor Lrp5 is a driver of idiopathic pulmonary fibrosis.
24897288 2014 LRP5 polymorphisms and response to alendronate treatment in Chinese postmenopausal women with osteoporosis.
24885293 2014 Association of LRP5 genotypes with osteoporosis in Tunisian post-menopausal women.
24743782 2014 Molecular simulation analysis of the structure complex of C2 domains of DKK family members and ?-propeller domains of LRP5/6: explaining why DKK3 does not bind to LRP5/6.
24736728 2014 Genetic analysis of high bone mass cases from the BARCOS cohort of Spanish postmenopausal women.
24715757 2014 Identification of two novel LRP5 mutations in families with familial exudative vitreoretinopathy.
24706814 2014 Whole-exome sequencing reveals LRP5 mutations and canonical Wnt signaling associated with hepatic cystogenesis.
24606091 2014 Elevated circulating Sclerostin concentrations in individuals with high bone mass, with and without LRP5 mutations.
24479426 2014 Low-density lipoprotein receptor-related protein 5 governs Wnt-mediated osteoarthritic cartilage destruction.
24431302 2014 Wnt signaling in midbrain dopaminergic neuron development and regenerative medicine for Parkinson's disease.
24412065 2014 Multivesicular GSK3 sequestration upon Wnt signaling is controlled by p120-catenin/cadherin interaction with LRP5/6.
24403228 2013 LRP5 knockdown: effect on prostate cancer invasion growth and skeletal metastasis in vitro and in vivo.
24376863 2013 Genetic analysis of the relationship between bone mineral density and low-density lipoprotein receptor-related protein 5 gene polymorphisms.
24337955 2014 Replication study of three functional polymorphisms associated with bone mineral density in a cohort of Spanish women.
24266894 2014 LRP5 negatively regulates differentiation of monocytes through abrogation of Wnt signalling.
24249740 2014 Multistage genome-wide association meta-analyses identified two new loci for bone mineral density.
24130145 Polymorphism of LRP5, but not of TNFRSF11B, is associated with a decrease in bone mineral density in postmenopausal Maya-Mestizo women.
24115276 2014 The regulation and deregulation of Wnt signaling by PARK genes in health and disease.
23800666 2013 Aberrant and alternative splicing in skeletal system disease.
23490293 2013 Low-density lipoprotein receptor-related protein 5 gene polymorphisms and genetic susceptibility to abdominal aortic aneurysm.
23441120 2013 Genetic variants of FZD4 and LRP5 genes in patients with advanced retinopathy of prematurity.
23318847 2013 The A242T mutation in the low-density lipoprotein receptor-related protein 5 gene in one Chinese family with osteosclerosis.
23242660 2013 Association of LRP5 haplotypes with osteoporosis in Mexican women.
23238007 2013 Genetic predictors of skeletal outcomes in healthy fertile women: the Bonturno study.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23077402 2012 Identification of FZD4 and LRP5 mutations in 11 of 49 families with familial exudative vitreoretinopathy.
23054017 2013 The joint effect of cigarette smoking and polymorphisms on LRP5, LEPR, near MC4R and SH2B1 genes on metabolic syndrome susceptibility in Taiwan.
23041840 2013 Genetic studies on components of the Wnt signalling pathway and the severity of joint destruction in rheumatoid arthritis.
22988876 2012 The importance of Wnt signalling for neurodegeneration in Parkinson's disease.
22848540 2012 LRP5 regulates development of lung microvessels and alveoli through the angiopoietin-Tie2 pathway.
22696217 2012 Characterization of the interaction of sclerostin with the low density lipoprotein receptor-related protein (LRP) family of Wnt co-receptors.
22589387 2012 The structural basis of DKK-mediated inhibition of Wnt/LRP signaling.
22513174 2012 Bone morphogenetic protein-2-induced Wnt/?-catenin signaling pathway activation through enhanced low-density-lipoprotein receptor-related protein 5 catabolic activity contributes to hypertrophy in osteoarthritic chondrocytes.
22504420 2012 Genome-wide meta-analysis identifies 56 bone mineral density loci and reveals 14 loci associated with risk of fracture.
22487062 2012 Mutations in LRP5 cause primary osteoporosis without features of OI by reducing Wnt signaling activity.
22303459 2012 Activation of Wnt signaling by chemically induced dimerization of LRP5 disrupts cellular homeostasis.
22207519 2012 Wnt, osteosarcoma, and future therapy.
22167346 2012 Genetic polymorphisms of the Wnt receptor LRP5 are differentially associated with trochanteric and cervical hip fractures.
22000856 2011 Structural basis of Wnt signaling inhibition by Dickkopf binding to LRP5/6.
21887268 2011 Dissecting molecular differences between Wnt coreceptors LRP5 and LRP6.
21885484 2011 The association of LRP5 gene polymorphisms with ankylosing spondylitis in a Chinese Han population.
21840657 2011 Association of the A1330V and V667M polymorphisms of LRP5 with bone mineral density in Greek peri- and postmenopausal women.
21821287 2011 A novel gene LRP5 on 11q13.2 is rearranged in two patients with acute myeloid leukemia.
21774378 2011 [Genetics of osteoporosis].
21542013 2011 Functional relevance of the BMD-associated polymorphism rs312009: novel involvement of RUNX2 in LRP5 transcriptional regulation.
21528003 2011 Functional analysis of disease-associated polymorphism LRP5.Q89R.
21471826 2011 Association between Wnt signaling pathway gene polymorphisms and bone response to hormone therapy in postmenopausal Korean women.
21471202 2011 Bone overgrowth-associated mutations in the LRP4 gene impair sclerostin facilitator function.
21432225 2011 A1330V polymorphism of the low-density lipoprotein receptor-related protein 5 gene and bone mineral density in Japanese male workers.
21407258 2011 Novel mutations affecting LRP5 splicing in patients with osteoporosis-pseudoglioma syndrome (OPPG).
21397183 2011 Two structural and functional domains of MESD required for proper folding and trafficking of LRP5/6.
21351148 2011 Levels of serotonin, sclerostin, bone turnover markers as well as bone density and microarchitecture in patients with high-bone-mass phenotype due to a mutation in Lrp5.
21147715 2010 Relationship between changes of bone mineral density over seven years and A1330V polymorphism of the low-density lipoprotein receptor-related protein 5 gene or lifestyle factors in Japanese female workers.
21116122 2010 LRP5 gene polymorphism and cortical bone.
20961463 2010 Genetic predisposition for femoral neck stress fractures in military conscripts.
20960157 2010 A polymorphism near osteoprotegerin gene confer risk of obesity in Uyghurs.
20953208 2010 No association between LRP5 gene polymorphisms and bone and obesity phenotypes in Chinese male-offspring nuclear families.
20926594 2011 Wnt receptors, bone mass, and fractures: gene-wide association analysis of LRP5 and LRP6 polymorphisms with replication.
20846389 2010 Differential expression of DKK-1 binding receptors on stromal cells and myeloma cells results in their distinct response to secreted DKK-1 in myeloma.
20630166 2010 Low-density lipoprotein receptor-related protein 5 polymorphisms are associated with bone mineral density in Greek postmenopausal women: an interaction with calcium intake.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20613673 Association between polymorphisms in Wnt signaling pathway genes and bone mineral density in postmenopausal Korean women.
20554715 2010 Analysis of recently identified osteoporosis susceptibility genes in Han Chinese women.
20534768 2010 OPG and RANK polymorphisms are both associated with cortical bone mineral density: findings from a metaanalysis of the Avon longitudinal study of parents and children and gothenburg osteoporosis and obesity determinants cohorts.
20393562 2010 APCDD1 is a novel Wnt inhibitor mutated in hereditary hypotrichosis simplex.
20340138 2010 Overview of the mutation spectrum in familial exudative vitreoretinopathy and Norrie disease with identification of 21 novel variants in FZD4, LRP5, and NDP.
20200978 2010 Replication of previous genome-wide association studies of bone mineral density in premenopausal American women.
20200960 2010 Patients with high-bone-mass phenotype owing to Lrp5-T253I mutation have low plasma levels of serotonin.
20198315 2010 Association of genetic variants with hemorrhagic stroke in Japanese individuals.
20146170 2010 Association of LPR5 polymorphism with bone mass density and cholesterol level in population of Chinese Han.
20141633 2010 Sp1 and KLF15 regulate basal transcription of the human LRP5 gene.
20101398 2010 Common genetic variation in the DKK1 gene is associated with hip axis length but not with bone mineral density and bone turnover markers in young adult men: results from the Odense Androgen Study.
20093360 2010 Reconstitution of a frizzled8.Wnt3a.LRP6 signaling complex reveals multiple Wnt and Dkk1 binding sites on LRP6.
20045498 2010 Low-density lipoprotein receptor-related protein 5 (LRP5) variation in fracture prone children.
20034086 2010 Various types of LRP5 mutations in four patients with osteoporosis-pseudoglioma syndrome: identification of a 7.2-kb microdeletion using oligonucleotide tiling microarray.
19948975 2009 Integrative predictive model of coronary artery calcification in atherosclerosis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19898734 2009 Analysis of association of LRP5, LRP6, SOST, DKK1, and CTNNB1 genes with bone mineral density in a Slovenian population.
19851296 2010 Assessment of a polymorphism of SDK1 with hypertension in Japanese Individuals.
19810105 2010 Low-density lipoprotein receptor-related protein 5 (LRP5) expression in human osteoarthritic chondrocytes.
19801982 2009 Twenty bone-mineral-density loci identified by large-scale meta-analysis of genome-wide association studies.
19789208 2009 Body composition and bone mineral density in children with premature adrenarche and the association of LRP5 gene polymorphisms with bone mineral density.
19746449 2009 A cell-based Dkk1 binding assay reveals roles for extracellular domains of LRP5 in Dkk1 interaction and highlights differences between wild-type and the high bone mass mutant LRP5(G171V).
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19673927 2010 Low density lipoprotein receptor-related protein 5 (LRP5) mutations and osteoporosis, impaired glucose metabolism and hypercholesterolaemia.
19629617 2010 Replication study of candidate genes/loci associated with osteoporosis based on genome-wide screening.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19571442 2009 A1330V variant of the low-density lipoprotein receptor-related protein 5 (LRP5) gene decreases Wnt signaling and affects the total body bone mineral density in Japanese women.
19506792 2010 The role of cigarette smoking and statins in the development of postmenopausal osteoporosis: a pilot study utilizing the Marshfield Clinic Personalized Medicine Cohort.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19336475 2009 Integrated associations of genotypes with multiple blood biomarkers linked to coronary heart disease risk.
19324841 2009 Clinical and molecular evaluation of probands and family members with familial exudative vitreoretinopathy.
19233690 2009 Gene expression profiling of peripheral blood in patients with abdominal aortic aneurysm.
19225709 2009 No association between hip geometry and four common polymorphisms associated with fracture: the Danish osteoporosis prevention study.
19177549 2009 A mutation in the signal sequence of LRP5 in a family with an osteoporosis-pseudoglioma syndrome (OPPG)-like phenotype indicates a novel disease mechanism for trinucleotide repeats.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19158955 2009 The internally truncated LRP5 receptor presents a therapeutic target in breast cancer.
19148563 2009 LRP5 Polymorphisms and response to risedronate treatment in osteoporotic men.
19147944 Gene targeting approaches in mice: assessing the roles of LRP5 and LRP6 in osteoblasts.
19107203 2008 Direct inhibition of GSK3beta by the phosphorylated cytoplasmic domain of LRP6 in Wnt/beta-catenin signaling.
19023643 2009 A1330V polymorphism of low-density lipoprotein receptor-related protein 5 gene and self-reported incident fractures in Japanese female patients with rheumatoid arthritis.
18932002 2009 Association between the A1330V polymorphism of the low-density lipoprotein receptor-related protein 5 gene and bone mineral density: a meta-analysis.
18825883 2008 Three years follow-up of pamidronate therapy in two brothers with osteoporosis-pseudoglioma syndrome (OPPG) carrying an LRP5 mutation.
18762581 2008 Caprin-2 enhances canonical Wnt signaling through regulating LRP5/6 phosphorylation.
18721193 2009 LRP5 in premature adrenarche and in metabolic characteristics of prepubertal children.
18684085 2008 A haplotype-based analysis of the LRP5 gene in relation to osteoporosis phenotypes in Spanish postmenopausal women.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18602879 2008 Osteoporosis-pseudoglioma syndrome: description of 9 new cases and beneficial response to bisphosphonates.
18588671 2008 Association between LRP5 polymorphism and bone mineral density: a Bayesian meta-analysis.
18524778 2008 Structural insight into the mechanisms of Wnt signaling antagonism by Dkk.
18521528 2008 The binding between sclerostin and LRP5 is altered by DKK1 and by high-bone mass LRP5 mutations.
18502762 2008 Characterization of the Kremen-binding site on Dkk1 and elucidation of the role of Kremen in Dkk-mediated Wnt antagonism.
18493104 2008 Lack of association of LRP5 and LRP6 polymorphisms with type 2 diabetes mellitus in the Japanese population.
18455228 2008 Bone mineral density, osteoporosis, and osteoporotic fractures: a genome-wide association study.
18418639 2008 Replication of associations between LRP5 and ESRRA variants and bone density in premenopausal women.
18406176 2008 Radiographic osteoarthritis at three joint sites and FRZB, LRP5, and LRP6 polymorphisms in two population-based cohorts.
18350154 2008 Evidence against a human cell-specific role for LRP6 in anthrax toxin entry.
18349089 2008 Large-scale analysis of association between LRP5 and LRP6 variants and osteoporosis.
18285546 2008 A PAI-1 (SERPINE1) polymorphism predicts osteonecrosis in children with acute lymphoblastic leukemia: a report from the Children's Oncology Group.
18073493 2008 Association of low-density lipoprotein receptor-related protein 5 (LRP5) promoter SNP with peak bone mineral density in Chinese women.
18058054 2007 Polymorphisms in the low-density lipoprotein receptor-related protein 5 (LRP5) gene are associated with peak bone mass in non-sedentary men: results from the Odense androgen study.
18044981 2007 An LRP5 receptor with internal deletion in hyperparathyroid tumors with implications for deregulated WNT/beta-catenin signaling.
18026682 2008 Large-scale association study between two coding LRP5 gene polymorphisms and bone phenotypes and fractures in men.
17972053 2007 Combination of the C1429T polymorphism in the G-protein beta-3 subunit gene and the A1330V polymorphism in the low-density lipoprotein receptor-related protein 5 gene is a risk factor for hypercholesterolaemia.
17955262 2008 Moderate reduction of Norrin signaling activity associated with the causative missense mutations identified in patients with familial exudative vitreoretinopathy.
17953969 2008 Low-density lipoprotein receptor-related protein-5 C/T polymorphism in exon 18 is associated with C peptide and proinsulin levels in control women and patients with polycystic ovary syndrome.
17700537 2008 Low-density lipoprotein receptor-related protein 5 (LRP5) mediates the prostate cancer-induced formation of new bone.
17680723 2007 Patients with high bone mass phenotype exhibit enhanced osteoblast differentiation and inhibition of adipogenesis of human mesenchymal stem cells.
17505772 2007 The effect of LRP5 polymorphisms on bone mineral density is apparent in childhood.
17488095 2007 Requirement for natively unstructured regions of mesoderm development candidate 2 in promoting low-density lipoprotein receptor-related protein 6 maturation.
17437160 2007 A novel mutation in the LRP5 gene is associated with osteoporosis-pseudoglioma syndrome.
17307038 2007 LRP5 coding polymorphisms influence the variation of peak bone mass in a normal population of French-Canadian women.
17306638 2007 Association of a single-nucleotide variation (A1330V) in the low-density lipoprotein receptor-related protein 5 gene (LRP5) with bone mineral density in adult Japanese women.
17295608 2007 Novel LRP5 missense mutation in a patient with a high bone mass phenotype results in decreased DKK1-mediated inhibition of Wnt signaling.
17276019 2007 Structure-based mutation analysis shows the importance of LRP5 beta-propeller 1 in modulating Dkk1-mediated inhibition of Wnt signaling.
17241106 2007 Low-density lipoprotein receptor-related protein 5 (LRP5) gene polymorphisms are associated with bone mass in both Chinese and whites.
17229572 2007 1,25-Dihydroxyvitamin D3 induces expression of the Wnt signaling co-regulator LRP5 via regulatory elements located significantly downstream of the gene's transcriptional start site.
17223614 2007 The A1330V polymorphism of the low-density lipoprotein receptor-related protein 5 gene (LRP5) associates with low peak bone mass in young healthy men.
17202888 2007 Q89R polymorphism in the LDL receptor-related protein 5 gene is associated with spinal osteoarthritis in postmenopausal Japanese women.
17137849 2007 Genetic variation at the low-density lipoprotein receptor-related protein 5 (LRP5) locus modulates Wnt signaling and the relationship of physical activity with bone mineral density in men.
17087607 2007 Association of C/T polymorphism in the LRP5 gene with circulating follicle stimulating hormone in Caucasian postmenopausal women.
17086708 2006 [Association of polymorphism of low density lipoprotein receptor-related protein 5 Q89R, A1330V with bone mineral density in premenopausal northern Chinese women].
17052975 2006 LRP5 mutations linked to high bone mass diseases cause reduced LRP5 binding and inhibition by SOST.
17002572 2006 Bone density ligand, Sclerostin, directly interacts with LRP5 but not LRP5G171V to modulate Wnt activity.
16958596 2006 Low-density lipoprotein receptor-related protein 5 and vitamin D receptor gene polymorphisms in relation to vitamin D levels in menopause.
16956801 2007 Influence of an LRP5 cytoplasmic SNP on Wnt signaling and osteoblastic differentiation.
16929062 2006 Reduced bone mineral density and hyaloid vasculature remnants in a consanguineous recessive FEVR family with a mutation in LRP5.
16772034 2006 Verification of predicted alternatively spliced Wnt genes reveals two new splice variants (CTNNB1 and LRP5) and altered Axin-1 expression during tumour progression.
16754270 2006 Low-density lipoprotein receptor-related protein 5 variant Q89R is associated with hypertension in Japanese females.
16723389 2006 Polymorphisms of the low-density lipoprotein receptor-related protein 5 (LRP5) gene are associated with obesity phenotypes in a large family-based association study.
16679074 2006 A family with osteoporosis pseudoglioma syndrome due to compound heterozygosity of two novel mutations in the LRP5 gene.
16631011 2006 Human degenerative valve disease is associated with up-regulation of low-density lipoprotein receptor-related protein 5 receptor-mediated bone formation.
16622736 2006 Assessment of linkage and association of 13 genetic loci with bone mineral density.
16613987 2006 1,25-Dihydroxyvitamin D3 regulates the expression of low-density lipoprotein receptor-related protein 5 via deoxyribonucleic acid sequence elements located downstream of the start site of transcription.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16513652 2006 Negative regulation of LRP6 function by casein kinase I epsilon phosphorylation.
16355283 2006 Common genetic variation of the low-density lipoprotein receptor-related protein 5 and 6 genes determines fracture risk in elderly white men.
16252235 2005 Clinical and molecular findings in osteoporosis-pseudoglioma syndrome.
16234968 2005 Missense mutations in LRP5 are not a common cause of idiopathic osteoporosis in adult men.
16168727 2005 LRP5 gene polymorphisms and idiopathic osteoporosis in men.
16115379 2005 Association of polymorphisms in low-density lipoprotein receptor-related protein 5 gene with bone mineral density in postmenopausal Chinese women.
15981244 2005 Complexity of the genotype-phenotype correlation in familial exudative vitreoretinopathy with mutations in the LRP5 and/or FZD4 genes.
15979013 2005 Haplotypes of the low-density lipoprotein receptor-related protein 5 (LRP5) gene: are they a risk factor in osteoarthritis?
15923613 2005 Reduced affinity to and inhibition by DKK1 form a common mechanism by which high bone mass-associated missense mutations in LRP5 affect canonical Wnt signaling.
15908424 2005 SOST is a ligand for LRP5/LRP6 and a Wnt signaling inhibitor.
15824861 2005 Oropharyngeal skeletal disease accompanying high bone mass and novel LRP5 mutation.
15824851 2005 Heterozygous mutations in the LDL receptor-related protein 5 (LRP5) gene are associated with primary osteoporosis in children.
15781005 2005 Genetic and environmental determinants of bone mineral density in Chinese women.
15778503 2005 Sclerostin binds to LRP5/6 and antagonizes canonical Wnt signaling.
15777745 2005 LRP5 gene polymorphisms predict bone mass and incident fractures in elderly Australian women.
15619672 2005 Contribution of the LRP5 gene to normal variation in peak BMD in women.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15355556 2004 Influence of LRP5 polymorphisms on normal variation in BMD.
15346351 2004 Autosomal recessive familial exudative vitreoretinopathy is associated with mutations in LRP5.
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15221492 2004 Association of a single-nucleotide polymorphism in low-density lipoprotein receptor-related protein 5 gene with bone mineral density.
15201508 2004 Association between bone mineral density and LDL receptor-related protein 5 gene polymorphisms in young Korean men.
15143163 2004 The LRP5 high-bone-mass G171V mutation disrupts LRP5 interaction with Mesd.
15084453 2004 LDL receptor-related proteins 5 and 6 in Wnt/beta-catenin signaling: arrows point the way.
15077203 2004 Polymorphisms in the low-density lipoprotein receptor-related protein 5 (LRP5) gene are associated with variation in vertebral bone mass, vertebral bone size, and stature in whites.
15035989 2004 Vascular development in the retina and inner ear: control by Norrin and Frizzled-4, a high-affinity ligand-receptor pair.
15024691 2004 Mutations in LRP5 or FZD4 underlie the common familial exudative vitreoretinopathy locus on chromosome 11q.
14735475 2004 Expression of LDL receptor-related protein 5 (LRP5) as a novel marker for disease progression in high-grade osteosarcoma.
14731402 2004 A mechanism for Wnt coreceptor activation.
14727154 2004 LRP5, low-density-lipoprotein-receptor-related protein 5, is a determinant for bone mineral density.
12857724 2003 Functional characterization of WNT7A signaling in PC12 cells: interaction with A FZD5 x LRP6 receptor complex and modulation by Dickkopf proteins.
12817748 2003 High bone mass in mice expressing a mutant LRP5 gene.
12700977 2003 Linkage and association mapping of the LRP5 locus on chromosome 11q13 in type 1 diabetes.
12581525 2003 Mesd encodes an LRP5/6 chaperone essential for specification of mouse embryonic polarity.
12579474 2003 Six novel missense mutations in the LDL receptor-related protein 5 (LRP5) gene in different conditions with an increased bone density.
12509515 2003 Low-density lipoprotein receptor-related protein 5 (LRP5) is essential for normal cholesterol metabolism and glucose-induced insulin secretion.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12121999 2002 A novel set of Wnt-Frizzled fusion proteins identifies receptor components that activate beta -catenin-dependent signaling.
12054167 2002 Localization of the gene causing autosomal dominant osteopetrosis type I to chromosome 11q12-13.
12015390 2002 High bone density due to a mutation in LDL-receptor-related protein 5.
11741193 2002 A mutation in the LDL receptor-related protein 5 gene results in the autosomal dominant high-bone-mass trait.
11719191 2001 LDL receptor-related protein 5 (LRP5) affects bone accrual and eye development.
11516963 2001 Wnt signalling: antagonistic Dickkopfs.
11448771 2001 Head inducer Dickkopf-1 is a ligand for Wnt coreceptor LRP6.
11433302 2001 Novel mechanism of Wnt signalling inhibition mediated by Dickkopf-1 interaction with LRP6/Arrow.
11401438 2001 The sequence and gene characterization of a 400-kb candidate region for IDDM4 on chromosome 11q13.
11336703 2001 Low-density lipoprotein receptor-related protein-5 binds to Axin and regulates the canonical Wnt signaling pathway.
11029007 2000 LDL-receptor-related proteins in Wnt signal transduction.
10049586 1999 Molecular cloning of mouse Lrp7(Lr3) cDNA and chromosomal mapping of orthologous genes in mouse and human.
9831343 1998 Autosomal recessive familial exudative vitreoretinopathy: evidence for genetic heterogeneity.
9790987 1998 Molecular cloning and characterization of LR3, a novel LDL receptor family protein with mitogenic activity.
9714764 1998 Cloning of a novel member of the low-density lipoprotein receptor family.
9199553 1997 Linkage of a gene causing high bone mass to human chromosome 11 (11q12-13)
8659519 1996 Osteoporosis-pseudoglioma syndrome, a disorder affecting skeletal strength and vision, is assigned to chromosome region 11q12-13.
7775583 1995 Identification of the low density lipoprotein receptor-related protein (LRP) as an endocytic receptor for thrombospondin-1.