Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.60
PubTator Score 1.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
Pick disease 1894 1.5e-04
lung cancer 4740 2.5e-04
ependymoma 4679 1.3e-03
medulloblastoma, large-cell 6241 2.0e-03
progressive supranuclear palsy 676 1.1e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (5)

Disease log2 FC p
ependymoma 2.900 1.3e-03
lung cancer -1.500 2.5e-04
medulloblastoma, large-cell -1.200 2.0e-03
Pick disease -1.300 1.5e-04
progressive supranuclear palsy -1.200 1.1e-02

Gene RIF (3)

AA Sequence

MKLTSEKLPKNPFYASVSQYAAKNQKFFQWKKEKTDYTHANLVDKALQLLKERILKGDTLAYFLRGQLYF      1 - 70
EEGWYEEALEQFEEIKEKDHQATYQLGVMYYDGLGTTLDAEKGVDYMKKILDSPCPKARHLKFAAAYNLG     71 - 140
RAYYEGKGVKRSNEEAERLWLIAADNGNPKASVKAQSMLGLYYSTKEPKELEKAFYWHSEACGNGNLESQ    141 - 210
GALGLMYLYGQGIRQDTEAALQCLREAAERGNVYAQGNLVEYYYKMKFFTKCVAFSKRIADYDEVHDIPM    211 - 280
IAQVTDCLPEFIGRGMAMASFYHARCLQLGLGITRDETTAKHYYSKACRLNPALADELHSLLIRQRI       281 - 347
//

Text Mined References (10)

PMID Year Title