Property Summary

NCBI Gene PubMed Count 14
PubMed Score 4.31
PubTator Score 3.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
active ulcerative colitis -2.279 7.4e-03
astrocytic glioma -1.100 5.0e-02
diabetes mellitus -1.500 1.6e-03
group 3 medulloblastoma 1.100 2.0e-02
intraductal papillary-mucinous adenoma (... -1.300 1.4e-02
intraductal papillary-mucinous carcinoma... -1.300 9.3e-03
intraductal papillary-mucinous neoplasm ... -1.500 3.8e-02
lung cancer 1.500 1.0e-02
lung carcinoma 2.000 1.8e-30
malignant mesothelioma -1.100 2.8e-04
medulloblastoma, large-cell 1.700 1.2e-02
non-small cell lung cancer 1.473 2.8e-14
osteosarcoma 2.476 5.5e-06
ovarian cancer 1.200 5.2e-04
pediatric high grade glioma 1.100 1.3e-02
tuberculosis -1.700 1.3e-05

 CSPA Cell Line (1)

Gene RIF (4)

AA Sequence

MACRWSTKESPRWRSALLLLFLAGVYGNGALAEHSENVHISGVSTACGETPEQIRAPSGIITSPGWPSEY      1 - 70
PAKINCSWFIRANPGEIITISFQDFDIQGSRRCNLDWLTIETYKNIESYRACGSTIPPPYISSQDHIWIR     71 - 140
FHSDDNISRKGFRLAYFSGKSEEPNCACDQFRCGNGKCIPEAWKCNNMDECGDSSDEEICAKEANPPTAA    141 - 210
AFQPCAYNQFQCLSRFTKVYTCLPESLKCDGNIDCLDLGDEIDCDVPTCGQWLKYFYGTFNSPNYPDFYP    211 - 280
PGSNCTWLIDTGDHRKVILRFTDFKLDGTGYGDYVKIYDGLEENPHKLLRVLTAFDSHAPLTVVSSSGQI    281 - 350
RVHFCADKVNAARGFNATYQVDGFCLPWEIPCGGNWGCYTEQQRCDGYWHCPNGRDETNCTMCQKEEFPC    351 - 420
SRNGVCYPRSDRCNYQNHCPNGSDEKNCFFCQPGNFHCKNNRCVFESWVCDSQDDCGDGSDEENCPVIVP    421 - 490
TRVITAAVIGSLICGLLLVIALGCTCKLYSLRMFERRSFETQLSRVEAELLRREAPPSYGQLIAQGLIPP    491 - 560
VEDFPVCSPNQASVLENLRLAVRSQLGFTSVRLPMAGRSSNIWNRIFNFARSRHSGSLALVSADGDEVVP    561 - 630
SQSTSREPERNHTHRSLFSVESDDTDTENERRDMAGASGGVAAPLPQKVPPTTAVEATVGACASSSTQST    631 - 700
RGGHADNGRDVTSVEPPSVSPARHQLTSALSRMTQGLRWVRFTLGRSSSLSQNQSPLRQLDNGVSGREDD    701 - 770
DDVEMLIPISDGSSDFDVNDCSRPLLDLASDQGQGLRQPYNATNPGVRPSNRDGPCERCGIVHTAQIPDT    771 - 840
CLEVTLKNETSDDEALLLC                                                       841 - 859
//

Text Mined References (15)

PMID Year Title