Property Summary

NCBI Gene PubMed Count 338
PubMed Score 327.12
PubTator Score 843.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
malignant mesothelioma -2.200 1.1e-07
astrocytic glioma 1.300 1.2e-02
ependymoma 1.500 9.1e-03
oligodendroglioma 1.700 2.1e-03
psoriasis -2.000 4.6e-05
glioblastoma 1.200 3.8e-04
primary pancreatic ductal adenocarcinoma 1.079 1.7e-02
fibroadenoma -1.300 1.3e-02
diabetes mellitus -1.100 1.0e-02
pilocytic astrocytoma 1.700 8.0e-08
lung carcinoma -2.300 6.1e-36
spina bifida 1.482 5.0e-02
mucosa-associated lymphoid tissue lympho... 2.554 5.0e-02
ductal carcinoma in situ -1.300 4.4e-03
invasive ductal carcinoma -1.500 2.2e-03
ovarian cancer 1.300 1.5e-04

Gene RIF (256)

PMID Text
26634655 Suggest role for LRP1/PARP1 signaling in endothelial cell proliferation and retinal neovascularization induced by hypoxia.
26285183 Circulating soluble LRP1 concentrations were associated with the occurrence of carotid atherosclerosis in a hypercholesterolemia population.
26206901 alpha1-antitrypsin internalization is a clathrin-dependent and low-density lipoprotein receptor-related protein 1-mediated endocytosis process.
26188720 Data suggest that aortic but not circulating LRP1 is downregulated in patients with AAA and indicates a possible role for this protein in clearing an aneurysm-relevant ligand.
26142438 LRP1 as a pathogenic gene for autosomal recessive Keratosis pilaris atrophicans and keratosis pilaris
26031789 LRP1 variants may be associated with risk of ischaemic stroke.
25937287 Lrp1-antisense directly binds to high-mobility group box 2 (Hmgb2) and inhibits the activity of Hmgb2 to enhance Srebp1a-dependent transcription of Lrp1.
25936756 LRP1, p38 MAPK and ERK1/2 mediate the internalization of beta-amyloid 1-42 in neurons.
25918169 domain CR9 appears to be critical for LRP1-mediated AgLDL binding and internalization in hVSMCs. Our results open new avenues for an innovative anti-VSMC foam cell-based strategy for the treatment of vascular lipid deposition in atherosclerosis
25903134 The interaction between factor VIII and LRP1 occurs over an extended surface containing multiple lysine residues.
25800007 it was suggested that a cell surface-expressed beta-galactoside binding protein, galectin-8, was involved in factor V endocytosis.
25730041 Statistically significant associations were also found for the PS1 1/2 polymorphism in both the dominant and recessive genetic models, whereas no association was found for the LRP C/T polymorphism
25393517 Th1 and Th2 cytokine responses differentially regulate T-cell expression of TSP-1 and LRP1 and motility.
25300797 Two recurrent fusion genes associated with the 12q locus, LRP1-SNRNP25 and KCNMB4-CCND3, were by RT-PCR, Sanger sequencing and FISH, and were found to be osteosarcoma specific in a validation cohort of 240 other sarcomas.
25238221 rs1466535 LRP1 polymorphism is not a significant and independent risk factor for carotid artery stenosis
25131918 In idiopathic dilated cardiomyopathy myocardium, LRP1 was found to move to lipid rafts as compared to control myocardium where it is almost undetectable.
25015123 An increased shedding of LRP1 followed Abeta exposure in human brain endothelial cells. When Abeta was co-treated with each apoE isoform, Abeta-induced shedding was reduced with apoE2 and apoE3. Lipoprotein receptor shedding in the presence of apoE4 increased.
24947444 Placental LRP1 protein expression was significantly higher in women who exhibited greater decreases in serum hemopexin from mid-gestation to term
24877199 Integrin ligands and CXCL12 stimulated motility and enhanced cell surface expression of LRP1, intact TSP-1 and a 130,000 MW TSP-1 fragment while preventing formation of a de-adhesion-coupled 110 000 MW TSP-1 fragment.
24796846 The anti-invasive effect of 2'-hydroxycinnamaldehyde was mitigated with receptor-associated protein pretreatment, suggesting that low-density lipoprotein receptor-related protein 1 is essential for the effects of 2'-hydroxycinnamaldehyde
24666322 HIV-1 Tat increases in inhibitory synapse number in neurons are dependent on LRP binding and NMDAR activation but not PSD95 ubiquitination
24661974 The molecular mechanisms involved at distinct levels in the regulation of LRP-1, from its expression to the proper location and stability at the cell surface are discussed. Review.
24596678 conclusion, C667T polymorphism of LRP-1 is moderately but significantly associated with global and regional amyloid deposition in AD.
24591168 The CD91 (alpha2 -macroglobulin receptor) was expressed only by monocytes and to a consistent level among subjects.
24529141 The results suggest that the LRP1 promoter polymorphism c.1-25C>G determines a lack of response to aggregated LDL and an exacerbated response to AngII.
24525843 LRP-1 overexpression caused by the miR-205 down-regulation may play a role in the abnormal proliferation of Dermatofibrosarcoma protuberans cells via directly regulating extracellular signal-regulated kinase phosphorylation.
24504736 In liver, LRP1 plays an important role in regulating the plasma levels of factor VIII. In the vasculature LRP1 plays a protective role from the development of aneurysms. Review.
24484584 Two new variants, including one nonsense SNP in the Marfan syndrome gene FBN1 and one missense mutation in exon 15 of LRP1, which may be related to the phenotype of the patients were identified
24474687 This study highlights that the affinity between a ligand and LRP1 dictates the rate of internalization and suggests that LRP1 is a major traffic controller of the two aggrecanases, especially under inflammatory conditions, where the protein levels of ADAMTS-4 increase, but those of ADAMTS-5 do not.
24423473 Suggest rs1466535 LRP1 SNP is a susceptibility factor for abdominal aortic aneurysms in an Italian population.
24198379 HIV-1 Tat increases in inhibitory synapse number in neurons are dependent on LRP binding and NMDAR activation but not PSD95 ubiquitination
24139096 Results demonstrat that cilostazol enhances LRP1 expression in liver by activating PPARgamma through the PPRE in the LRP1 promoter. Increased hepatic LRP1 may be essential for the reduction of circulating triglycerides brought about by cilostazol.
24129569 LRP1 assembles unique co-receptor systems to initiate cell signaling in response to tissue-type plasminogen activator and myelin-associated glycoprotein.
24126057 Hsp90alpha utilizes a unique transmembrane signaling mechanism via the NPVY motif of LRP-1 to promote cell motility and wound healing.
24072693 Determine a crucial role of LRP1-mediated Pyk2 phosphorylation on hypoxia-induced MMP-9 activation and hVSMC migration and therefore in hypoxia-induced vascular remodeling.
24054777 Suggest that a reduction in LRP1 protein expression may be associated with aneurysm progression.
24030729 In the case of LRP mRNA, significantly higher expression is observed in acute myeloid leukemia (AML) M4,5,6 FAB subtypes, when compared to AML M3 subtypes.
23959870 Data indicate that copper (Cu) down-regulated LRP1 and reduced amyloid-beta (Abeta) binding in brain endothelial cells.
23936774 This paper attempts to summarize some aspects on the cellular and molecular bases of endocytic and signaling functions of LRP-1 that modulate extra- and pericellular levels of matrix proteinases
23922991 These data demonstrate that phosphorylated forms of LRP1 and PDGFRbeta compete for SHP-2 binding, and that expression of LRP1 attenuates SHP-2-mediated PDGF signaling events.
23898049 In preeclamptic placentas LRP-1 expression is lower in small-for-gestational-age delivering mothers.
23812296 The effects of UPA/UPAR on migration of lipid-loaded cells occurred through the binding to LRP-1.
23755898 The expression of CD91 and TLR4 in trophoblasts and decidual cells may play a role in birth initiation and pathological early pregnancy termination after release of gp96 at the maternal- fetal interface from cells rich in gp96
23675525 While PCSK9 is capable of inducing degradation of LRP-1, the latter is not an essential factor for LDLR regulation, but the LDLR effectively competes with LRP-1 for PCSK9 activity.
23640058 Data indicate that alpha2-macroglobulin (alpha2M*), through its receptor LRP1, induces cellular migration of Muller glial cells by a mechanism that involves MT1-MMP intracellular traffic to the plasma membrane by a Rab11-dependent recycling pathway.
23517243 Results suggest that in hypothyroidism, decreased expression of hepatic LRP1 may be associated with reduced clearance of circulating remnant lipoproteins.
23498137 These results suggest that NNK inhibits IGFBP-3 expression to abrogate anti-tumor actions of the IGFBP-3/IGFBP-3R system in smoking-induced lung cancer.
23484911 genetic association studies in populations in Minnesota and Utah: Data suggest that 11 SNPs in LRP1 are associated with changes in chylomicron levels in blood during postprandial period following a high-fat meal (by healthy subjects).
23425335 This supports the notion that de novo mutations in LRP1 are extremely rare in schizophrenia
23404896 We have detected an interaction between saturated fat intake and LRP1 genotype for obesity-related traits in a US Puerto Rican population.
23386614 Prion protein-mediated toxicity of amyloid-beta oligomers requires lipid rafts and the transmembrane LRP1
23386606 the CD91/IKK/NF-kappaB signaling cascade is involved in secreted HSP90alpha-induced TCF12 expression, leading to E-cadherin down-regulation and enhanced CRC cell migration/invasion
23357958 Dietary SFA and LRP1 genotype may interactively influence anthropometric traits.
23267846 HIV-1 Tat increases in inhibitory synapse number in neurons are dependent on LRP binding and NMDAR activation but not PSD95 ubiquitination
23264627 LRP1 functions as a receptor for endocytosis of intracellular components released during cellular damage and necrosis
23241409 Aggregated LDL prolongs the half life of LRP1 by preventing the receptor ubiquitinylation, at least in part, through CHFR targeting.
23228658 The results support the possibility that plasma levels of sLRP and sRAGE may help with the diagnosis of Alzheimer's disease
23212659 Emodin downregulated AR in LNCaP under normoxic and hypoxia-like conditions and LRP1 under normoxia. Emodin upregulated LRP1 in other cell lines, except HCT-15, under normoxic, and even more markedly under hypoxia-like conditions.
23186781 The T allele of LRP1 C766T polymorphism is associated with decreased risk of sporadic Alzheimer's disease in a northern Han Chinese population.
23167255 LRP1 transactivation mediated by GULP1
23166318 analysis of difference in regulation of extracellular tissue inhibitor of metalloproteinases-3 levels by cell membrane-bound and shed low density lipoprotein receptor-related protein 1
23096408 Epicardial overexpression of certain lipoprotein receptors such as LRP1 and VLDLR expression may play a key role in the alterations of lipid metabolism associated with type 2 diabetes mellitus.
23064555 LRP-1 dictates physiological and pathological catabolism of aggrecan in cartilage as a key modulator of the extracellular activity of ADAMTS-5.
22967844 LRP1 mRNA and protein were not related to cerebral amyloid angiopathy severity and presence.
22914594 LRP-1 mediates uptake of amyloid-beta peptides in smooth muscle cells resulting in cell death.
22873206 results suggest that LRP1 upregulation is key for myocardial cholesterol ester accumulation in ischemic human hearts and that LRP1 may be a target to prevent the deleterious effects of myocardial cholesterol accumulation in ischemic cardiomyopathy
22822085 the cell surface receptor, LRP1, mediates VacA-induced autophagy and apoptosis.
22819221 LRP1 polymorphism showed a significant association with premature cardiovascular disease
22817990 LRP1 restricts human cytomegalovirus infectivity by controlling the availability of cholesterol for the virion envelope, and increased LRP1 expression is likely a defense response to infection.
22711991 LRP-1--CD44 is a new cell surface complex regulating tumor cell adhesion
22534531 STAT6 and LRP1 polymorphisms are associated with food allergen sensitization in Mexican children.
22467855 we demonstrate that GPC3 binds through its HS chains to LRP1, and that this interaction causes the removal of GPC3 from the lipid rafts domains.
22454511 LRP1 mediates the transport of CCN2.
22427881 Low LRP1 expression was associated with poor HCC prognosis and high metastatic potential.
22412921 enhanced CD91/LRP-1 surface expression occurs rapidly following HIV-1 infection, and is triggered by the activation of extracellular TGF-beta.
22412921 HIV-1 Tat increases in inhibitory synapse number in neurons are dependent on LRP binding and NMDAR activation but not PSD95 ubiquitination
22392894 LRP1 deficient cells showed higher levels of phosphorylated ERK1,2.
22347399 triglyceride-rich lipoprotein uptake at the LRP-1 receptor and body mass index
22298529 studies indicate that TNF-alpha and IL-1beta regulate LRP-1 in PMCs and that LRP-1 thereby contributes to a range of pathophysiologically relevant responses of these cells.
22238606 LRP1 enables apoE to accumulate in an early endosomal recycling compartment that serves as a pool for the intracellular formation and subsequent re-secretion of apoE-enriched HDL particles.
22081071 cath-D modulates the growth of fibroblasts by inhibiting LRP1-regulated intramembrane proteolysis in the breast tumor microenvironment
22072275 genome-wide association studies have successfully identified four new genetic variants associated with migraine in the LRP1, TRPM8, and PRDM16 genes
22055160 SNP rs1466535, located within intron 1 of low-density-lipoprotein receptor-related protein 1 was significantly associated (p (1/4) 0.0042) with abdominal aortic aneurysm.
22034896 LRP-1 expression is differentially regulated in endometrial carcinomas, and has potential clinical and diagnostic utility
22027013 Te results of this study suggested taht genetic variations in MMEL1, ECE1, ECE2, AGER, PLG, PLAT, NR1H3, MMP3, LRP1, TTR, NR1H2, and MMP9 genes do not play major role among the Finnish AD patient cohort.
21968187 Phosphorylation of LRP1 regulates the interaction with Fe65.
21966368 Data show that LPL, FABP4, LRP1 and ASP expression in visceral adipose tissue was higher in lean controls, while in subcutaneous adipose tissue, LPL and FABP4 expression were also higher in lean controls.
21951552 HIV-1 Tat increases in inhibitory synapse number in neurons are dependent on LRP binding and NMDAR activation but not PSD95 ubiquitination
21676865 low density lipoprotein receptor-related protein 1 (LRP1) interacts with integrin alphaMbeta2 at specific binding sites
21676498 Increased expression of LRP1 may not only disrupt cholesterol homeostasis but may also contribute to some of the neurobiological features ofAlzheimer Disease,including plaque deposition.
21671167 The presence of the G allele at the 25CG (rs35282763) polymorphism of the LRP1 is not associated with a reduced risk of myocardial infarction in a Chinese Han population.
21650223 LRP-N-terminus is phosphorylated at tyrosine-4507 and competes for binding to Fe65 when in complex with amyloid precursor protein (APP/AICD).
21610072 ERK cascade can act as a coincidence detector to decode the simultaneous engagement of a receptor tyrosine kinase and of LRP-1 and as a signal integrator that encodes this information in a spatially and temporally distinct biological signal
21518850 cholesterol exerts an important control on LRP-1 levels and function at the plasma membrane by modulating shedding of its ectodomain, and therefore represents a novel regulator of extracellular proteolytic activities
21496869 patients with low-density lipoprotein receptor-related protein 1-positive tumors had higher cholesterol levels (62.5%, 5/8) than those with low-density lipoprotein receptor-related protein 1-negative tumors (40%, 19/47).
21471105 Increased LRP-1 shedding prevents the cellular clearance of matrix metalloproteinases and might thereby contribute to tissue destruction in acute respiratory distress syndrome lungs.
21454812 Hypoxia upregulates LRP1 expression and aggregated low-density lipoprotein-derived intracellular cholesterol esters accumulation in human vascular smooth muscle cells through HIF-1alpha induction.
21408136 A dual role for eHsp90 in transducing signaling via LRP1, and in facilitating LRP1 co-receptor function for EphA2, is reported.
21391865 REVIEW: pathophysiology of the role of LRP1 in hemostasis
21383009 The IGFBP-3/IGFBP-3R system therefore plays a pivotal role in the pathogenesis of asthma and can serve as a newly identified potential therapeutic target for this debilitating disease.
21325077 Data show that LRP1 expression is associated with improved lung cancer outcomes.
21212259 Premature ligand-receptor interaction during biosynthesis limits the production of growth factor midkine and its receptor LDL receptor-related protein 1.
21165580 Tanshinone IIA acts via p38 MAPK to induce apoptosis and the down-regulation of ERCC1 and lung-resistance protein in cisplatin-resistant ovarian cancer.
21054788 Both MBL and L-ficolin were found to bind CD91. The MBL-CD91 interaction was time- and concentration-dependent and could be inhibited by known ligands of CD91.
20980003 both SREBP-1 and SREBP-2 negatively modulated LRP1 transcription.
20869432 Abeta impairs its own efflux from the brain by oxidation of its transporter LRP1, leading to increased Abeta deposition in brain, thereby contributing to subsequent cognitive impairment in Alzheimer disease.
20826454 binding partner for pro-cath-D in fibroblasts, promotes fibroblast outgrowth
20716178 CD91 is a receptor for C1q and that this multifunctional scavenger receptor uses a subset of its ligand-binding sites for clearance of C1q and C1q bound material.
20685197 In addition to its role in beta-amyloid precursor protein (APP) trafficking, LRP1 affects APP processing by competing for cleavage by beta-site APP cleaving enzyme 1 (BACE1).
20644732 Study identified ERK and JNK as the main molecular relays by which LRP-1 regulates focal adhesion disassembly of malignant cells to support invasion
20637261 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20610799 sLRP1 is generated in inflammation and may regulate inflammation by its effects on macrophage physiology
20568118 Fe65 and Dab1 compete for binding to APP. Dab1 significantly decreased the amount of APP bound to LRP and the level of secreted APP and APP-CTF in LRP expressing cells
20558745 Secreted heat shock protein 90alpha induces colorectal cancer cell invasion through CD91/LRP-1 and NF-kappaB-mediated integrin alphaV expression.
20535486 Observational study of gene-disease association. (HuGE Navigator)
20472562 LRP1 and TSP2 stimulate Notch activity by driving trans-endocytosis of the Notch ectodomain into the signal-sending cell
20468060 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20381197 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20220145 Low density lipoprotein receptor-related protein 1 forms a signaling complex with platelet-derived growth factor receptor-beta in endosomes and regulates activation of the Mitogen-Activated Protein Kinase pathway.
20167577 Observational study of gene-disease association. (HuGE Navigator)
20101615 CD91 and members of the SR family efficiently direct Hsp70:peptide complexes into the MHC class II presentation pathway and thus enhance antigen-specific CD4(+) T cell responses.
20048078 LRP1 bound A2M* found to be associated with an inhibition of tumor cell proliferation, migration, invasion, spheroid formation, and anchorage-independent growth.
19968964 LRP1 was a major receptor for phagocytosis of trichosanthin (TCS) in JAR and BeWo cell lines and might be the molecular basis of TCS abortificient and anti-choriocarcinoma activity.
19948975 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19885591 down-regulation of MDR genes MDR1, MRP2, and LRP is responsible for the improvement in the chemotherapeutic sensitivity of hSSTR2-expressing pancreatic cancer cells
19823686 LRP1 has a dual role in the control of adipogenesis and lipid homeostasis
19815552 LRP1 mediates anti-apoptotic function in neurons by regulating insulin receptor and the Akt survival pathway
19795391 LRP1 exerts remarkable effects to retain the mature phenotype of chondrocytes as a critical mediator of cell signaling.
19684401 These data suggest that the synergistic effects (epistasis) between tau and LRP1 might modify the risk of Alzheimer's disease in an APO-E epsilon4 allele-independent fashion
19684401 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19665999 These results, for the first time, demonstrate that expression of human LRP1 is regulated in part by MIR205, leading to decreased tumor cell migration.
19664312 This study confirms the association between genetic variants in LRP1 and aMCI. Moreover, we have identified a relationship between LRP1 genetic variation and specific aspects of neurocognitive function.
19664312 Observational study of gene-disease association. (HuGE Navigator)
19631509 Salivary gland epithelial cells (SGEC) functionally express CD91 receptor, suggesting that this pathway might be involved in the presentation of exogenous antigens in SGEC.
19446849 To ascertain whether a defect in the low-density lipoprotein (LDL) receptor gene (LDLR) in children with heterozygous familial hypercholesterolemia (heFH) identifies subjects at greater risk of developing premature coronary artery disease
19439404 common mode of serpin binding, involving lysines on the serpin engaging the acidic region around the calcium binding site of the CR domain
19420105 Observational study of gene-disease association. (HuGE Navigator)
19393132 76.6 % of renal cell carcinoma samples revealed positive results for LRP.
19383717 Report participation of the lipoprotein receptor LRP1 in hypoxia-HSP90alpha autocrine signaling to promote keratinocyte migration.
19336475 Observational study of gene-disease association. (HuGE Navigator)
19299462 Low-density lipoprotein receptor-related protein 1 is an essential receptor for myelin phagocytosis.
19251705 Overexpression of RanBP9 resulted in the enhancement of APP interactions with LRP and BACE1 and increased lipid raft association of APP.
19176371 Data strongly suggest that LRP1 promotes glioblastoma cell migration and invasion by regulating the expression and function of MMP2 and MMP9 perhaps via an ERK-dependent signaling pathway.
19105203 Observational study of gene-disease association. (HuGE Navigator)
19036954 HIV-1 Tat increases in inhibitory synapse number in neurons are dependent on LRP binding and NMDAR activation but not PSD95 ubiquitination
19036715 identified a nuclear signaling mechanism through which the low-density lipoprotein receptor-related protein 1 (LRP1) limits transcription of lipopolysaccharide (LPS)-inducible genes
19008962 These results indicate that, in addition to the ligand-induced endocytosis of uPAR, efficient surface expression and membrane trafficking might also be driven by an uncommon macropinocytic mechanism coupled with rapid recycling to the cell surface.
18990694 LRP1 stimulates a canonical Wnt5a signaling pathway that prevents cholesterol accumulation.
18941243 Interaction of gp96 with CD91 is a productive event that directly and specifically triggers functional responses in plasmacytoid dendritic cells.
18940800 rapid LRP1-dependent internalization of A beta occurs under the blood-brain barrier-specific cellular context
18834984 Insulin stimulates hepatic low density lipoprotein receptor-related protein 1 (LRP1) to increase postprandial lipoprotein clearance.
18706476 The polymorphism of LRP C766T was strongly associated with AD and T allele might be a protective factor for AD in Chinese Han population.
18685438 Interaction of the A2 domain of F8 with LRP follows the general mode, requires dissociation of factor VIII from von Willebrand factor, and is activation sensitive.
18683150 Observational study of gene-disease association. (HuGE Navigator)
18653767 a novel role for TSP1 signaling through the calreticulin/LRP1 co-complex in tissue remodeling and fibrotic responses through stimulation of anoikis resistance.
18648652 alpha2ML1 binding to the low density lipoprotein receptor-related protein 1 (LRP1) reveals a new role for LRP1 in the human epidermis
18489712 Mediates, in part, the transport of Kunitz domain-derived peptide angiopep-2 across the blood-brain barrier.
18381291 Shp2 binds most strongly when both of the NPXY motifs in LRP1 are phosphorylated
18373737 The last 37 residues of LRP cytoplasmic tail (LRP-C37) lacking the NPxY motifs and FE65 binding mediate the core pro-amyloidogenic activity of soluble cytoplasmic tail of LRP (LRP-ST).
18321860 These results provide new insights into the mechanism of a tPA-induced, LRP1-mediated gating mechanism for NMDA receptors.
18317248 In this Brazilian population, the T -219 polymorphism in the low-density lipoprotein receptor-related protein (LRP) gene was associated with an increased risk for AD.
18317248 Observational study of gene-disease association. (HuGE Navigator)
18288927 Review examines LRP1 mediated clearance mechanisms of amyloid beta-peptide and proposes in Alzheimer's disease.
18281370 Ang II upregulates LRP1 receptor expression and LRP1-mediated aggregated LDL uptake in vascular cells.
18277139 the binding sites for VLDLR (very low density lipoprotein receptor) and LRP (low-density lipoprotein receptor-related protein) within Factor VIII overlap and the A2 site becomes exposed upon physiological activation of Factor VIII.
18231792 in Rheumatoid arthritis both synovial cells and skin fibroblasts expressed high levels of cell surface CD91; synovial cells expressed high levels of Hsp70 (heat shock protein 70)
18194421 A model is hypothesized where FV binding to a specific receptor facilitates binding & endocytosis of a second FV molecule by LRP-1, or a related family member.
18166789 CD91 and other members of the LDL receptor family are not strongly implicated in FVIII internalization by monocyte-derived dendritic cells
18156630 Perindoprilat modulates the activity of lipoprotein receptor-related protein in human mesangial cells
18037995 tPA induces LRP-1 tyrosine phosphorylation, which in turn facilitates the LRP-1-mediated recruitment of beta1 integrin and downstream ILK signaling, thereby leading to myofibroblast activation.
17974965 Study shows that activation of protein kinase C-alpha (PKC-alpha) phosphorylated and down-regulated LRP expression.
17942912 Increased cell death was observed when LRP-1-silenced cells were exposed to CoCl2. LRP-1-silenced cells expressed decreased levels of VEGF in response to O2. Results suggest that LRP-1 facilitates the development and growth of cancer metastases in vivo.
17908054 the FXNPXY63 motif of LRP1 not only governs cellular localization of the receptor but also exerts multiple functional effects on signalling pathways involved in cell growth regulation
17889283 Low density lipoprotein receptor-related protein polymorphisms are not risk factors for venous thromboembolism.
17711877 transglutaminase interacts in vitro and on the cell surface with the major endocytic receptor, low-density lipoprotein receptor-related protein 1, and demonstrate the requirement for this receptor in the endocytosis of transglutaminase.
17709443 Observational study of gene-disease association. (HuGE Navigator)
17694066 Soluble circulating LRP (sLRP) provides key endogenous peripheral 'sink' activity for amyloid beta in humans.
17620659 agLDL-LRP1 engagement induces adipocyte differentiation-related protein overexpression in both monocyte-derived macrophages and human vascular smooth muscle cells
17570828 results suggest a Plg-mediated internalization mechanism for the clearance of sMTf via annexin II and LRP
17360663 HIV-1 Tat increases in inhibitory synapse number in neurons are dependent on LRP binding and NMDAR activation but not PSD95 ubiquitination
17258834 HIV-1 Tat increases in inhibitory synapse number in neurons are dependent on LRP binding and NMDAR activation but not PSD95 ubiquitination
17203175 LRP is expressed in colorectal cancer and forms complexes with u-PA and its inhibitor
17155964 Observational study of gene-disease association. (HuGE Navigator)
17012232 LRP binds and endocytoses Abeta42 both directly and via apoE but endocytosed Abeta42 is not completely degraded and accumulates in intraneuronal lysosomes
16956829 Observational study of gene-disease association. (HuGE Navigator)
16929535 IAP family proteins may the prognosis of multiple myeloma patients in association with chemotherapy-induced overexpression of MDR1 or LRP.
16839343 propose that LRP binding of non-activated FVIII is mediated via the FVIII light chain while in activated FVIII both the heavy and light chain contribute to LRP binding.
16821592 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16807059 LRP-mediated clearance of uPA is one of the mechanisms involved during the control of human thyroid carcinoma cell invasion.
16697675 HIV-1 Tat increases in inhibitory synapse number in neurons are dependent on LRP binding and NMDAR activation but not PSD95 ubiquitination
16697011 Low density lipoproteins stimulate LRP1 transcription and decrease SREBP-2 active form which negatively regulates LRP1 transcription
16606588 Meta-analysis of gene-disease association. (HuGE Navigator)
16459332 the urokinase/PAI-2 complex is a new high affinity ligand for the endocytosis receptor low density lipoprotein receptor-related protein
16407289 LRP-1 has a role in determining blood vessel structure and in angiogenesis
16402284 Observational study of gene-disease association. (HuGE Navigator)
16362633 Observational study of gene-disease association. (HuGE Navigator)
16328515 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16175004 Observational study of gene-disease association. (HuGE Navigator)
16167883 Review provides an overview of the structural and functional information that implicates transmembrane proteins CD91 and CD93 in complement 1q (C1q)-mediated functional effects, by promoting apoptotic clearance and phagocytosis, respectively. (Review)
16102056 LRP has roles in cell migration, proliferation and vascular permeability [review]
16040006 Observational study of gene-disease association. (HuGE Navigator)
15944146 PDGFR-beta activation promotes its association with the low density lipoprotein receptor-related protein
15925094 Observational study and meta-analysis of gene-disease association and gene-gene interaction. (HuGE Navigator)
15863833 like the LDL receptor, LRP prefers lipid-bound forms of apoE, but in contrast to the LDL receptor, both LRP and the VLDL receptor recognize all apoE isoforms
15800028 Increased surface expression of CD91 on CD14(+) monocytes is associated with the apparent HIV-1 resistance that is observed in HIV seronegative subjects.
15772078 deletion experiments suggested that the last 50 amino acid residues of LRP-soluble tail contain the important domain for altering APP processing and Abeta production
15749709 Data suggest that there is a close interaction between beta-secretase (BACE) and LRP1 on the cell surface in association with lipid rafts, and that LRP1 is a novel BACE substrate.
15705932 The protective effect of LRP1 in the vessel wall seems to be mainly due to its role in controlling certain signaling pathways.
15705569 endocytosis of LRP modulates cell surface distribution and processing of the beta-amyloid precursor protein
15647823 LRP1 plays a predominant role in human osteoblast expression of receptors of the LDLR family with a capacity for vitamin K1 uptake through chylomicron receptor endocytosis
15634227 Observational study of gene-disease association. (HuGE Navigator)
15591119 Activation of nuclear factor-kappaB is critical for PF4-induced E-selectin expression, and LRP is the cell surface receptor mediating this effect
15328156 the absence of low-density lipoprotein receptor-related protein resulted in complete abrogation of beta2-integrin-dependent adhesion to endothelial cells in a perfusion system
15294142 Low-density lipoprotein receptor-related protein LRP interaction with amyloid beta-peptide (Abeta) and/or Abeta-induced LRP loss at the blood-brain barrier mediate brain accumulation of neurotoxic Abeta.
15288502 A direct influence of the LRP1 promoter polymorphism c.1-25C>G on the human in vivo LRP1 expression level was demonstrated in a survey of 448 German Caucasian subjects
15272003 phosphorylation of LRP by PKCalpha modulates the endocytic and signaling function of LRP by modifying its association with adaptor proteins
15264223 HIV-1 Tat increases in inhibitory synapse number in neurons are dependent on LRP binding and NMDAR activation but not PSD95 ubiquitination
15226301 low density lipoprotein receptor-related protein-1 binds to cell surface annexin VI
15135046 Low-density lipoprotein receptor-related protein intracellular domain co-localizes with MafB to the nucleus and negatively regulates its transcriptional activity, suggesting a possible role for LRP in brain development
15048651 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
15048651 We suggest that these regional variations in LRP1 genotype and allele frequencies in AD could be related to the different patterns of association between this polymorphism and the disease in various European studies
15001579 The low density lipoprotein receptor-related protein is a motogenic receptor for plasminogen activator inhibitor-1
14739301 LRP1 interacts with the human frizzled-1 (HFz1) and down-regulates the canonical Wnt signaling pathway
14699139 Low density lipoprotein receptor-related protein-1 promotes beta1 integrin maturation and transport to the cell surface
14645246 the presentation of LRP and the subsequent uptake of its ligands by malignant cells are both strongly regulated by MT1-MMP
14597676 LRP1 is the type V TGF-beta receptor and mediates growth inhibition by IGFBP-3
12960961 Data show that tissue plasminogen activator upregulates matrix metalloproteinase-9 in cell culture and in vivo, and that this is mediated by the low-density lipoprotein receptor-related protein.
12888553 low density lipoprotein receptor-related protein cytoplasmic domain has a novel signaling function, negatively impacting transcriptional activity of the APP, Fe65, and Tip60 complex in the nucleus
12857755 LRP1 has a role in inhibitin cell migration by binding to apoE, which activates cAMP-dependent protein kinase A
12807892 apoER2 has a role in platelet adhesion and thrombus formation, along with beta-2-glycoprotein i
12793904 Observational study of gene-disease association. (HuGE Navigator)
12793904 The T allele of the C766T polymorphism in the LRP1 gene is associated with an increased risk of breast cancer development in women of Caucasian origin.
12750160 dendritic cells derived from patients with Kaposi sarcoma in AIDS retain the ability to prime the adaptive arm of the immune system through CD91, leading to phenotypic activation and stimulation of tetramer-positive CD8+ cytotoxic T cells.
12732394 Observational study of gene-disease association. (HuGE Navigator)
12672816 is involved in the Lf-enhanced collagen gel contractile activity of WI-38 fibroblasts by converting the Lf binding signal into the activation of ERK1/2 and MLCK
12637503 Allosteric modulation of ligand binding to low density lipoprotein receptor-related protein by the receptor-associated protein requires critical lysine residues within its carboxyl-terminal domain
12555245 Observational study of gene-disease association. (HuGE Navigator)
12531796 High levels of CD91 may be a host factor that contributes to the maintenance of long-term nonprogression of HIV-1-infected "true" long-term nonprogressors
12522212 LRP may function as a regulator of blood coagulation
12522143 Low density lipoprotein receptor-related protein and factor IXa share structural requirements for binding to the A3 domain of coagulation factor VIII
12402342 Observational study of gene-disease association. (HuGE Navigator)
12394648 Observational study of gene-disease association. (HuGE Navigator)
11992244 The involvement of human low-density lipoprotein receptor-related protein (LRP) in the clearance of FVIII was established by infusion of hLRP in vWF-deficient mice.
11931574 Observational study of gene-disease association. (HuGE Navigator)
11907044 investigation of cleavage site resulting in release of intracellular domain
11867643 mediates fibronectin catabolism and inhibits fibronectin accumulation on cell surface; functions as a catabolic receptor for fibronectin
11823454 function in facilitating cellular uptake and degrdation of beta-amyloid peptide
11729193 Interaction of CED-6/GULP, an adapter protein involved in engulfment of apoptotic cells with CED-1 and CD91/low density lipoprotein receptor-related protein (LRP).
11720768 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
11600564 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
11479307 LRP was involved essentially for the cell-mediated LDL oxidation by 12/15-lipoxygenase expressed in J774A.1 cells, suggesting an important pathophysiological role of this receptor-enzyme system as the initial trigger of the progression of atherosclerosis.
11436125 Observational study of gene-disease association. (HuGE Navigator)
11100124 HIV-1 Tat increases in inhibitory synapse number in neurons are dependent on LRP binding and NMDAR activation but not PSD95 ubiquitination
11076057 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)

AA Sequence

MLTPPLLLLLPLLSALVAAAIDAPKTCSPKQFACRDQITCISKGWRCDGERDCPDGSDEAPEICPQSKAQ      1 - 70
RCQPNEHNCLGTELCVPMSRLCNGVQDCMDGSDEGPHCRELQGNCSRLGCQHHCVPTLDGPTCYCNSSFQ     71 - 140
LQADGKTCKDFDECSVYGTCSQLCTNTDGSFICGCVEGYLLQPDNRSCKAKNEPVDRPPVLLIANSQNIL    141 - 210
ATYLSGAQVSTITPTSTRQTTAMDFSYANETVCWVHVGDSAAQTQLKCARMPGLKGFVDEHTINISLSLH    211 - 280
HVEQMAIDWLTGNFYFVDDIDDRIFVCNRNGDTCVTLLDLELYNPKGIALDPAMGKVFFTDYGQIPKVER    281 - 350
CDMDGQNRTKLVDSKIVFPHGITLDLVSRLVYWADAYLDYIEVVDYEGKGRQTIIQGILIEHLYGLTVFE    351 - 420
NYLYATNSDNANAQQKTSVIRVNRFNSTEYQVVTRVDKGGALHIYHQRRQPRVRSHACENDQYGKPGGCS    421 - 490
DICLLANSHKARTCRCRSGFSLGSDGKSCKKPEHELFLVYGKGRPGIIRGMDMGAKVPDEHMIPIENLMN    491 - 560
PRALDFHAETGFIYFADTTSYLIGRQKIDGTERETILKDGIHNVEGVAVDWMGDNLYWTDDGPKKTISVA    561 - 630
RLEKAAQTRKTLIEGKMTHPRAIVVDPLNGWMYWTDWEEDPKDSRRGRLERAWMDGSHRDIFVTSKTVLW    631 - 700
PNGLSLDIPAGRLYWVDAFYDRIETILLNGTDRKIVYEGPELNHAFGLCHHGNYLFWTEYRSGSVYRLER    701 - 770
GVGGAPPTVTLLRSERPPIFEIRMYDAQQQQVGTNKCRVNNGGCSSLCLATPGSRQCACAEDQVLDADGV    771 - 840
TCLANPSYVPPPQCQPGEFACANSRCIQERWKCDGDNDCLDNSDEAPALCHQHTCPSDRFKCENNRCIPN    841 - 910
RWLCDGDNDCGNSEDESNATCSARTCPPNQFSCASGRCIPISWTCDLDDDCGDRSDESASCAYPTCFPLT    911 - 980
QFTCNNGRCININWRCDNDNDCGDNSDEAGCSHSCSSTQFKCNSGRCIPEHWTCDGDNDCGDYSDETHAN    981 - 1050
CTNQATRPPGGCHTDEFQCRLDGLCIPLRWRCDGDTDCMDSSDEKSCEGVTHVCDPSVKFGCKDSARCIS   1051 - 1120
KAWVCDGDNDCEDNSDEENCESLACRPPSHPCANNTSVCLPPDKLCDGNDDCGDGSDEGELCDQCSLNNG   1121 - 1190
GCSHNCSVAPGEGIVCSCPLGMELGPDNHTCQIQSYCAKHLKCSQKCDQNKFSVKCSCYEGWVLEPDGES   1191 - 1260
CRSLDPFKPFIIFSNRHEIRRIDLHKGDYSVLVPGLRNTIALDFHLSQSALYWTDVVEDKIYRGKLLDNG   1261 - 1330
ALTSFEVVIQYGLATPEGLAVDWIAGNIYWVESNLDQIEVAKLDGTLRTTLLAGDIEHPRAIALDPRDGI   1331 - 1400
LFWTDWDASLPRIEAASMSGAGRRTVHRETGSGGWPNGLTVDYLEKRILWIDARSDAIYSARYDGSGHME   1401 - 1470
VLRGHEFLSHPFAVTLYGGEVYWTDWRTNTLAKANKWTGHNVTVVQRTNTQPFDLQVYHPSRQPMAPNPC   1471 - 1540
EANGGQGPCSHLCLINYNRTVSCACPHLMKLHKDNTTCYEFKKFLLYARQMEIRGVDLDAPYYNYIISFT   1541 - 1610
VPDIDNVTVLDYDAREQRVYWSDVRTQAIKRAFINGTGVETVVSADLPNAHGLAVDWVSRNLFWTSYDTN   1611 - 1680
KKQINVARLDGSFKNAVVQGLEQPHGLVVHPLRGKLYWTDGDNISMANMDGSNRTLLFSGQKGPVGLAID   1681 - 1750
FPESKLYWISSGNHTINRCNLDGSGLEVIDAMRSQLGKATALAIMGDKLWWADQVSEKMGTCSKADGSGS   1751 - 1820
VVLRNSTTLVMHMKVYDESIQLDHKGTNPCSVNNGDCSQLCLPTSETTRSCMCTAGYSLRSGQQACEGVG   1821 - 1890
SFLLYSVHEGIRGIPLDPNDKSDALVPVSGTSLAVGIDFHAENDTIYWVDMGLSTISRAKRDQTWREDVV   1891 - 1960
TNGIGRVEGIAVDWIAGNIYWTDQGFDVIEVARLNGSFRYVVISQGLDKPRAITVHPEKGYLFWTEWGQY   1961 - 2030
PRIERSRLDGTERVVLVNVSISWPNGISVDYQDGKLYWCDARTDKIERIDLETGENREVVLSSNNMDMFS   2031 - 2100
VSVFEDFIYWSDRTHANGSIKRGSKDNATDSVPLRTGIGVQLKDIKVFNRDRQKGTNVCAVANGGCQQLC   2101 - 2170
LYRGRGQRACACAHGMLAEDGASCREYAGYLLYSERTILKSIHLSDERNLNAPVQPFEDPEHMKNVIALA   2171 - 2240
FDYRAGTSPGTPNRIFFSDIHFGNIQQINDDGSRRITIVENVGSVEGLAYHRGWDTLYWTSYTTSTITRH   2241 - 2310
TVDQTRPGAFERETVITMSGDDHPRAFVLDECQNLMFWTNWNEQHPSIMRAALSGANVLTLIEKDIRTPN   2311 - 2380
GLAIDHRAEKLYFSDATLDKIERCEYDGSHRYVILKSEPVHPFGLAVYGEHIFWTDWVRRAVQRANKHVG   2381 - 2450
SNMKLLRVDIPQQPMGIIAVANDTNSCELSPCRINNGGCQDLCLLTHQGHVNCSCRGGRILQDDLTCRAV   2451 - 2520
NSSCRAQDEFECANGECINFSLTCDGVPHCKDKSDEKPSYCNSRRCKKTFRQCSNGRCVSNMLWCNGADD   2521 - 2590
CGDGSDEIPCNKTACGVGEFRCRDGTCIGNSSRCNQFVDCEDASDEMNCSATDCSSYFRLGVKGVLFQPC   2591 - 2660
ERTSLCYAPSWVCDGANDCGDYSDERDCPGVKRPRCPLNYFACPSGRCIPMSWTCDKEDDCEHGEDETHC   2661 - 2730
NKFCSEAQFECQNHRCISKQWLCDGSDDCGDGSDEAAHCEGKTCGPSSFSCPGTHVCVPERWLCDGDKDC   2731 - 2800
ADGADESIAAGCLYNSTCDDREFMCQNRQCIPKHFVCDHDRDCADGSDESPECEYPTCGPSEFRCANGRC   2801 - 2870
LSSRQWECDGENDCHDQSDEAPKNPHCTSQEHKCNASSQFLCSSGRCVAEALLCNGQDDCGDSSDERGCH   2871 - 2940
INECLSRKLSGCSQDCEDLKIGFKCRCRPGFRLKDDGRTCADVDECSTTFPCSQRCINTHGSYKCLCVEG   2941 - 3010
YAPRGGDPHSCKAVTDEEPFLIFANRYYLRKLNLDGSNYTLLKQGLNNAVALDFDYREQMIYWTDVTTQG   3011 - 3080
SMIRRMHLNGSNVQVLHRTGLSNPDGLAVDWVGGNLYWCDKGRDTIEVSKLNGAYRTVLVSSGLREPRAL   3081 - 3150
VVDVQNGYLYWTDWGDHSLIGRIGMDGSSRSVIVDTKITWPNGLTLDYVTERIYWADAREDYIEFASLDG   3151 - 3220
SNRHVVLSQDIPHIFALTLFEDYVYWTDWETKSINRAHKTTGTNKTLLISTLHRPMDLHVFHALRQPDVP   3221 - 3290
NHPCKVNNGGCSNLCLLSPGGGHKCACPTNFYLGSDGRTCVSNCTASQFVCKNDKCIPFWWKCDTEDDCG   3291 - 3360
DHSDEPPDCPEFKCRPGQFQCSTGICTNPAFICDGDNDCQDNSDEANCDIHVCLPSQFKCTNTNRCIPGI   3361 - 3430
FRCNGQDNCGDGEDERDCPEVTCAPNQFQCSITKRCIPRVWVCDRDNDCVDGSDEPANCTQMTCGVDEFR   3431 - 3500
CKDSGRCIPARWKCDGEDDCGDGSDEPKEECDERTCEPYQFRCKNNRCVPGRWQCDYDNDCGDNSDEESC   3501 - 3570
TPRPCSESEFSCANGRCIAGRWKCDGDHDCADGSDEKDCTPRCDMDQFQCKSGHCIPLRWRCDADADCMD   3571 - 3640
GSDEEACGTGVRTCPLDEFQCNNTLCKPLAWKCDGEDDCGDNSDENPEECARFVCPPNRPFRCKNDRVCL   3641 - 3710
WIGRQCDGTDNCGDGTDEEDCEPPTAHTTHCKDKKEFLCRNQRCLSSSLRCNMFDDCGDGSDEEDCSIDP   3711 - 3780
KLTSCATNASICGDEARCVRTEKAAYCACRSGFHTVPGQPGCQDINECLRFGTCSQLCNNTKGGHLCSCA   3781 - 3850
RNFMKTHNTCKAEGSEYQVLYIADDNEIRSLFPGHPHSAYEQAFQGDESVRIDAMDVHVKAGRVYWTNWH   3851 - 3920
TGTISYRSLPPAAPPTTSNRHRRQIDRGVTHLNISGLKMPRGIAIDWVAGNVYWTDSGRDVIEVAQMKGE   3921 - 3990
NRKTLISGMIDEPHAIVVDPLRGTMYWSDWGNHPKIETAAMDGTLRETLVQDNIQWPTGLAVDYHNERLY   3991 - 4060
WADAKLSVIGSIRLNGTDPIVAADSKRGLSHPFSIDVFEDYIYGVTYINNRVFKIHKFGHSPLVNLTGGL   4061 - 4130
SHASDVVLYHQHKQPEVTNPCDRKKCEWLCLLSPSGPVCTCPNGKRLDNGTCVPVPSPTPPPDAPRPGTC   4131 - 4200
NLQCFNGGSCFLNARRQPKCRCQPRYTGDKCELDQCWEHCRNGGTCAASPSGMPTCRCPTGFTGPKCTQQ   4201 - 4270
VCAGYCANNSTCTVNQGNQPQCRCLPGFLGDRCQYRQCSGYCENFGTCQMAADGSRQCRCTAYFEGSRCE   4271 - 4340
VNKCSRCLEGACVVNKQSGDVTCNCTDGRVAPSCLTCVGHCSNGGSCTMNSKMMPECQCPPHMTGPRCEE   4341 - 4410
HVFSQQQPGHIASILIPLLLLLLLVLVAGVVFWYKRRVQGAKGFQHQRMTNGAMNVEIGNPTYKMYEGGE   4411 - 4480
PDDVGGLLDADFALDPDKPTNFTNPVYATLYMGGHGSRHSLASTDEKRELLGRGPEDEIGDPLA         4481 - 4544
//

Text Mined References (350)

PMID Year Title
26634655 2016 LRP1 Regulates Retinal Angiogenesis by Inhibiting PARP-1 Activity and Endothelial Cell Proliferation.
26285183 2015 Circulating soluble low-density lipoprotein receptor-related protein 1 (sLRP1) concentration is associated with hypercholesterolemia: A new potential biomarker for atherosclerosis.
26206901 2015 Low-density lipoprotein receptor-related protein 1 mediates ?1-antitrypsin internalization in CD4+ T lymphocytes.
26188720 2015 Plasma Low-density Lipoprotein Receptor-related Protein 1 Concentration is not Associated with Human Abdominal Aortic Aneurysm Presence.
26142438 2015 Whole exome sequencing identifies LRP1 as a pathogenic gene in autosomal recessive keratosis pilaris atrophicans.
26031789 2015 Low density lipoprotein receptor related protein 1 and 6 gene variants and ischaemic stroke risk.
25937287 2015 Antisense RNA controls LRP1 Sense transcript expression through interaction with a chromatin-associated protein, HMGB2.
25936756 2015 Mitogen-activated protein kinase signaling pathways promote low-density lipoprotein receptor-related protein 1-mediated internalization of beta-amyloid protein in primary cortical neurons.
25918169 2015 K Domain CR9 of Low Density Lipoprotein (LDL) Receptor-related Protein 1 (LRP1) Is Critical for Aggregated LDL-induced Foam Cell Formation from Human Vascular Smooth Muscle Cells.
25903134 2015 Factor VIII Interacts with the Endocytic Receptor Low-density Lipoprotein Receptor-related Protein 1 via an Extended Surface Comprising "Hot-Spot" Lysine Residues.
25800007 2015 Mechanisms Regulating Acquisition of Platelet-Derived Factor V/Va by Megakaryocytes.
25730041 2015 Association of PS1 1/2, ACE I/D, and LRP C/T polymorphisms with Alzheimer's disease in the Chinese population: a meta-analysis of case-control studies.
25514242 2014 LRP-1: functions, signaling and implications in kidney and other diseases.
25393517 2015 Antigen-induced regulation of T-cell motility, interaction with antigen-presenting cells and activation through endogenous thrombospondin-1 and its receptors.
25300797 2014 Recurrent LRP1-SNRNP25 and KCNMB4-CCND3 fusion genes promote tumor cell motility in human osteosarcoma.
25238221 2014 Role of rs1466535 low density lipoprotein receptor-related protein 1 (LRP1) gene polymorphism in carotid artery disease.
25131918 2014 Inverse relationship between raft LRP1 localization and non-raft ERK1,2/MMP9 activation in idiopathic dilated cardiomyopathy: potential impact in ventricular remodeling.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
25015123 2014 Apolipoprotein E isoform-specific effects on lipoprotein receptor processing.
24947444 2014 Placental heme receptor LRP1 correlates with the heme exporter FLVCR1 and neonatal iron status.
24877199 2014 Regulation of T-lymphocyte motility, adhesion and de-adhesion by a cell surface mechanism directed by low density lipoprotein receptor-related protein 1 and endogenous thrombospondin-1.
24796846 2014 LRP1-dependent pepsin clearance induced by 2'-hydroxycinnamaldehyde attenuates breast cancer cell invasion.
24661974 2014 Regulation of LRP-1 expression: make the point.
24596678 2014 LRP-1 polymorphism is associated with global and regional amyloid load in Alzheimer's Disease in humans in-vivo.
24591168 2014 Properties of human blood monocytes. I. CD91 expression and log orthogonal light scatter provide a robust method to identify monocytes that is more accurate than CD14 expression.
24529141 2014 Molecular and functional characterization of LRP1 promoter polymorphism c.1-25 C>G (rs138854007).
24525843 2014 miR-205 down-regulation promotes proliferation of dermatofibrosarcoma protuberans tumor cells by regulating LRP-1 and ERK phosphorylation.
24504736 2014 Low-density lipoprotein receptor-related protein-1: role in the regulation of vascular integrity.
24484584 2014 Exome sequencing identified new mutations in a Marfan syndrome family.
24474687 2014 Low density lipoprotein receptor-related protein 1 (LRP1)-mediated endocytic clearance of a disintegrin and metalloproteinase with thrombospondin motifs-4 (ADAMTS-4): functional differences of non-catalytic domains of ADAMTS-4 and ADAMTS-5 in LRP1 binding.
24423473 2015 Association of rs1466535 LRP1 but not rs3019885 SLC30A8 and rs6674171 TDRD10 gene polymorphisms with abdominal aortic aneurysm in Italian patients.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24139096 2014 The hypolipidemic effect of cilostazol can be mediated by regulation of hepatic low-density lipoprotein receptor-related protein 1 (LRP1) expression.
24129569 2013 LRP1 assembles unique co-receptor systems to initiate cell signaling in response to tissue-type plasminogen activator and myelin-associated glycoprotein.
24126057 2013 Extracellular heat shock protein 90 signals through subdomain II and the NPVY motif of LRP-1 receptor to Akt1 and Akt2: a circuit essential for promoting skin cell migration in vitro and wound healing in vivo.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
24072693 2013 Hypoxia induces metalloproteinase-9 activation and human vascular smooth muscle cell migration through low-density lipoprotein receptor-related protein 1-mediated Pyk2 phosphorylation.
24054777 2013 A pilot study on low-density lipoprotein receptor-related protein-1 in Chinese patients with abdominal aortic aneurysm.
24030729 2014 FLT3-ITD and MLL-PTD influence the expression of MDR-1, MRP-1, and BCRP mRNA but not LRP mRNA assessed with RQ-PCR method in adult acute myeloid leukemia.
23959870 2013 Low levels of copper disrupt brain amyloid-? homeostasis by altering its production and clearance.
23936774 2013 LRP-1: a checkpoint for the extracellular matrix proteolysis.
23922991 2013 The LDL receptor-related protein 1 (LRP1) regulates the PDGF signaling pathway by binding the protein phosphatase SHP-2 and modulating SHP-2- mediated PDGF signaling events.
23898049 2013 Is the atherosclerotic phenotype of preeclamptic placentas due to altered lipoprotein concentrations and placental lipoprotein receptors? Role of a small-for-gestational-age phenotype.
23812296 2013 UPA promotes lipid-loaded vascular smooth muscle cell migration through LRP-1.
23793025 2013 Genome-wide meta-analysis identifies new susceptibility loci for migraine.
23755898 2013 The significance of heat-shock protein gp96 and its receptors' CD91 and Toll-like receptor 4 expression at the maternal foetal interface.
23675525 2013 Proprotein convertase subtilisin/kexin type 9 (PCSK9) can mediate degradation of the low density lipoprotein receptor-related protein 1 (LRP-1).
23640058 2013 Activated ?2-macroglobulin induces Müller glial cell migration by regulating MT1-MMP activity through LRP1.
23517243 2013 Decreased expression of hepatic low-density lipoprotein receptor-related protein 1 in hypothyroidism: a novel mechanism of atherogenic dyslipidemia in hypothyroidism.
23498137 2013 Tobacco specific carcinogen 4-(methylnitrosamino)-1-(3-pyridyl)-1-butanone suppresses a newly identified anti-tumor IGFBP-3/IGFBP-3R system in lung cancer cells.
23484911 2013 The association between LRP-1 variants and chylomicron uptake after a high fat meal.
23425335 2013 Investigation of rare variants in LRP1, KPNA1, ALS2CL and ZNF480 genes in schizophrenia patients reflects genetic heterogeneity of the disease.
23404896 2013 Low-density lipoprotein receptor-related protein 1 variant interacts with saturated fatty acids in Puerto Ricans.
23386614 2013 Prion protein-mediated toxicity of amyloid-? oligomers requires lipid rafts and the transmembrane LRP1.
23386606 2013 Secreted heat shock protein 90? (HSP90?) induces nuclear factor-?B-mediated TCF12 protein expression to down-regulate E-cadherin and to enhance colorectal cancer cell migration and invasion.
23382219 2013 Structural basis for endosomal trafficking of diverse transmembrane cargos by PX-FERM proteins.
23357958 2013 Lipoprotein receptor-related protein 1 variants and dietary fatty acids: meta-analysis of European origin and African American studies.
23284291 2012 Genome-wide joint meta-analysis of SNP and SNP-by-smoking interaction identifies novel loci for pulmonary function.
23264627 2013 Identification of the low density lipoprotein (LDL) receptor-related protein-1 interactome in central nervous system myelin suggests a role in the clearance of necrotic cell debris.
23241409 2013 Aggregated low-density lipoprotein induces LRP1 stabilization through E3 ubiquitin ligase CHFR downregulation in human vascular smooth muscle cells.
23228658 2013 Decreased plasma levels of soluble low density lipoprotein receptor-related protein-1 (sLRP) and the soluble form of the receptor for advanced glycation end products (sRAGE) in the clinical diagnosis of Alzheimer's disease.
23212659 2014 Exploration of effects of emodin in selected cancer cell lines: enhanced growth inhibition by ascorbic acid and regulation of LRP1 and AR under hypoxia-like conditions.
23186781 2013 Association of polymorphisms in the LRP1 and A2M genes with Alzheimer's disease in the northern Chinese Han population.
23167255 2013 Engulfment adaptor phosphotyrosine-binding-domain-containing 1 (GULP1) is a nucleocytoplasmic shuttling protein and is transactivationally active together with low-density lipoprotein receptor-related protein 1 (LRP1).
23166318 2013 Differential regulation of extracellular tissue inhibitor of metalloproteinases-3 levels by cell membrane-bound and shed low density lipoprotein receptor-related protein 1.
23096408 2014 Low density lipoprotein receptor-related protein 1 is upregulated in epicardial fat from type 2 diabetes mellitus patients and correlates with glucose and triglyceride plasma levels.
23064555 2013 LRP-1-mediated endocytosis regulates extracellular activity of ADAMTS-5 in articular cartilage.
23033978 2012 Diagnostic exome sequencing in persons with severe intellectual disability.
22967844 2012 LRP1 expression in cerebral cortex, choroid plexus and meningeal blood vessels: relationship to cerebral amyloid angiopathy and APOE status.
22914594 2013 Influence of LRP-1 and apolipoprotein E on amyloid-? uptake and toxicity to cerebrovascular smooth muscle cells.
22873206 2012 Low density lipoprotein receptor-related protein 1 expression correlates with cholesteryl ester accumulation in the myocardium of ischemic cardiomyopathy patients.
22822085 2012 Low-density lipoprotein receptor-related protein-1 (LRP1) mediates autophagy and apoptosis caused by Helicobacter pylori VacA.
22819221 2012 LRP1 gene polymorphisms are associated with premature risk of cardiovascular disease in patients with familial hypercholesterolemia.
22817990 2012 Increased expression of LDL receptor-related protein 1 during human cytomegalovirus infection reduces virion cholesterol and infectivity.
22711991 2012 LRP-1--CD44, a new cell surface complex regulating tumor cell adhesion.
22683712 2012 Genome-wide association analysis identifies susceptibility loci for migraine without aura.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22534531 2012 STAT6 and LRP1 polymorphisms are associated with food allergen sensitization in Mexican children.
22467855 2012 LRP1 mediates Hedgehog-induced endocytosis of the GPC3-Hedgehog complex.
22454511 2012 Role of LRP1 in transport of CCN2 protein in chondrocytes.
22427881 2012 Low level of low-density lipoprotein receptor-related protein 1 predicts an unfavorable prognosis of hepatocellular carcinoma after curative resection.
22412921 2012 HIV-1 promotes intake of Leishmania parasites by enhancing phosphatidylserine-mediated, CD91/LRP-1-dependent phagocytosis in human macrophages.
22392894 2012 Low density lipoprotein receptor-related protein 1 modulates the proliferation and migration of human hepatic stellate cells.
22347399 2012 Preliminary evidence for an association between LRP-1 genotype and body mass index in humans.
22298529 2012 Lipoprotein receptor-related protein 1 regulates collagen 1 expression, proteolysis, and migration in human pleural mesothelial cells.
22238606 2012 Low density lipoprotein receptor-related protein 1 dependent endosomal trapping and recycling of apolipoprotein E.
22081071 2012 Cathepsin D is partly endocytosed by the LRP1 receptor and inhibits LRP1-regulated intramembrane proteolysis.
22072275 2012 Genetics of migraine in the age of genome-wide association studies.
22055160 2011 Abdominal aortic aneurysm is associated with a variant in low-density lipoprotein receptor-related protein 1.
22034896 2011 Low-density lipoprotein receptor-related protein 1 (LRP-1) is associated with highgrade, advanced stage and p53 and p16 alterations in endometrial carcinomas.
22027013 2012 Genetic analysis of genes involved in amyloid-? degradation and clearance in Alzheimer's disease.
21968187 2011 Phosphorylation of LRP1 regulates the interaction with Fe65.
21966368 2011 Adipose tissue gene expression of factors related to lipid processing in obesity.
21946350 2011 Genome-wide association and large-scale follow up identifies 16 new loci influencing lung function.
21676865 2011 Molecular basis for the interaction of low density lipoprotein receptor-related protein 1 (LRP1) with integrin alphaMbeta2: identification of binding sites within alphaMbeta2 for LRP1.
21676498 2012 Association of ApoE and LRP mRNA levels with dementia and AD neuropathology.
21671167 2011 Lack of association of common polymorphism of LRP1 gene with myocardial infarction in a Chinese Han population.
21666692 2011 Genome-wide association study reveals three susceptibility loci for common migraine in the general population.
21650223 2011 Protein interactions among Fe65, the low-density lipoprotein receptor-related protein, and the amyloid precursor protein.
21610072 2011 Signal integration and coincidence detection in the mitogen-activated protein kinase/extracellular signal-regulated kinase (ERK) cascade: concomitant activation of receptor tyrosine kinases and of LRP-1 leads to sustained ERK phosphorylation via down-regulation of dual specificity phosphatases (DUSP1 and -6).
21518850 2011 Cell cholesterol modulates metalloproteinase-dependent shedding of low-density lipoprotein receptor-related protein-1 (LRP-1) and clearance function.
21496869 2011 Low-density lipoprotein receptor-related protein 1 is associated with proliferation and invasiveness in Her-2/neu and triple-negative breast carcinomas.
21471105 2011 Shedding of low-density lipoprotein receptor–related protein-1 in acute respiratory distress syndrome.
21454812 2011 Hypoxia stimulates low-density lipoprotein receptor-related protein-1 expression through hypoxia-inducible factor-1? in human vascular smooth muscle cells.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21408136 2011 A novel extracellular Hsp90 mediated co-receptor function for LRP1 regulates EphA2 dependent glioblastoma cell invasion.
21391865 2011 Low-density lipoprotein receptor-related protein 1: new functions for an old molecule.
21383009 2011 Insulin-like growth factor-binding protein-3 (IGFBP-3) blocks the effects of asthma by negatively regulating NF-?B signaling through IGFBP-3R-mediated activation of caspases.
21325077 2011 Stromal LRP1 in lung adenocarcinoma predicts clinical outcome.
21269460 2011 Initial characterization of the human central proteome.
21212259 2011 Premature ligand-receptor interaction during biosynthesis limits the production of growth factor midkine and its receptor LDL receptor-related protein 1.
21165580 2011 Tanshinone IIA acts via p38 MAPK to induce apoptosis and the down-regulation of ERCC1 and lung-resistance protein in cisplatin-resistant ovarian cancer cells.
21054788 2010 CD91 interacts with mannan-binding lectin (MBL) through the MBL-associated serine protease-binding site.
20980003 2010 Selective role of sterol regulatory element binding protein isoforms in aggregated LDL-induced vascular low density lipoprotein receptor-related protein-1 expression.
20869432 2010 Oxidative modification to LDL receptor-related protein 1 in hippocampus from subjects with Alzheimer disease: implications for A? accumulation in AD brain.
20826454 2010 Pro-cathepsin D interacts with the extracellular domain of the beta chain of LRP1 and promotes LRP1-dependent fibroblast outgrowth.
20716178 2010 Direct interaction between CD91 and C1q.
20686565 2010 Biological, clinical and population relevance of 95 loci for blood lipids.
20685197 2010 The role of low-density receptor-related protein 1 (LRP1) as a competitive substrate of the amyloid precursor protein (APP) for BACE1.
20644732 2010 LRP-1 promotes cancer cell invasion by supporting ERK and inhibiting JNK signaling pathways.
20637261 2010 Lack of interaction between LRP1 and A2M polymorphisms for the risk of Alzheimer disease.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20610799 2010 Inflammatory mediators promote production of shed LRP1/CD91, which regulates cell signaling and cytokine expression by macrophages.
20568118 2010 Dab1 binds to Fe65 and diminishes the effect of Fe65 or LRP1 on APP processing.
20558745 2010 Secreted heat shock protein 90alpha induces colorectal cancer cell invasion through CD91/LRP-1 and NF-kappaB-mediated integrin alphaV expression.
20535486 2010 Capillary cerebral amyloid angiopathy identifies a distinct APOE epsilon4-associated subtype of sporadic Alzheimer's disease.
20472562 2010 Low density lipoprotein receptor-related protein-1 (LRP1) regulates thrombospondin-2 (TSP2) enhancement of Notch3 signaling.
20468060 2010 Genetic pathway-based hierarchical clustering analysis of older adults with cognitive complaints and amnestic mild cognitive impairment using clinical and neuroimaging phenotypes.
20381197 2011 ACE variants and risk of intracerebral hemorrhage recurrence in amyloid angiopathy.
20220145 2010 Low density lipoprotein receptor-related protein 1 (LRP1) forms a signaling complex with platelet-derived growth factor receptor-beta in endosomes and regulates activation of the MAPK pathway.
20167577 2010 Analysis of lipid pathway genes indicates association of sequence variation near SREBF1/TOM1L2/ATPAF2 with dementia risk.
20101615 2010 Involvement of CD91 and scavenger receptors in Hsp70-facilitated activation of human antigen-specific CD4+ memory T cells.
20048078 2010 Alpha2-macroglobulin inhibits the malignant properties of astrocytoma cells by impeding beta-catenin signaling.
19968964 2010 Low-density lipoprotein receptor-related protein 1 is an essential receptor for trichosanthin in 2 choriocarcinoma cell lines.
19948975 2009 Integrative predictive model of coronary artery calcification in atherosclerosis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19885591 2009 hSSTR2 expression and octreotide treatment reverses multidrug resistance of BxPC-3 human pancreatic cancer cells.
19823686 2009 LRP1 receptor controls adipogenesis and is up-regulated in human and mouse obese adipose tissue.
19815552 2009 Low density lipoprotein receptor-related protein 1 promotes anti-apoptotic signaling in neurons by activating Akt survival pathway.
19795391 2010 Role of the low-density lipoprotein receptor-related protein-1 in regulation of chondrocyte differentiation.
19684401 2009 Genetic interaction between tau and the apolipoprotein E receptor LRP1 Increases Alzheimer's disease risk.
19665999 2009 MicroRNA-205 inhibits tumor cell migration through down-regulating the expression of the LDL receptor-related protein 1.
19664312 2009 Association of the LRP1 gene and cognitive performance with amnestic mild cognitive impairment in elderly Chinese.
19631509 2009 Functional expression of the alpha 2-macroglobulin receptor CD91 in salivary gland epithelial cells.
19446849 2009 The type of LDLR gene mutation predicts cardiovascular risk in children with familial hypercholesterolemia.
19439404 2009 Specificity of binding of the low density lipoprotein receptor-related protein to different conformational states of the clade E serpins plasminogen activator inhibitor-1 and proteinase nexin-1.
19420105 2009 A candidate gene approach to genetic prognostic factors of IgA nephropathy--a result of Polymorphism REsearch to DIstinguish genetic factors Contributing To progression of IgA Nephropathy (PREDICT-IgAN).
19393132 2008 Multidrug resistance proteins in renal cell carcinoma.
19383717 2009 Participation of the lipoprotein receptor LRP1 in hypoxia-HSP90alpha autocrine signaling to promote keratinocyte migration.
19336475 2009 Integrated associations of genotypes with multiple blood biomarkers linked to coronary heart disease risk.
19299462 2009 Low-density lipoprotein receptor-related protein 1 is an essential receptor for myelin phagocytosis.
19251705 2009 Novel role of RanBP9 in BACE1 processing of amyloid precursor protein and amyloid beta peptide generation.
19176371 2009 Low-density lipoprotein receptor-related protein 1 promotes cancer cell migration and invasion by inducing the expression of matrix metalloproteinases 2 and 9.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19139490 2009 A strategy for precise and large scale identification of core fucosylated glycoproteins.
19105203 2009 An association analysis of Alzheimer disease candidate genes detects an ancestral risk haplotype clade in ACE and putative multilocus association between ACE, A2M, and LRRTM3.
19098903 2009 SRF and myocardin regulate LRP-mediated amyloid-beta clearance in brain vascular cells.
19036715 2008 Gamma-secretase limits the inflammatory response through the processing of LRP1.
19008962 2008 Clathrin and LRP-1-independent constitutive endocytosis and recycling of uPAR.
18990694 2009 LRP1 controls intracellular cholesterol storage and fatty acid synthesis through modulation of Wnt signaling.
18941243 2008 Human plasmacytoid dendritic cells interact with gp96 via CD91 and regulate inflammatory responses.
18940800 2008 The low density lipoprotein receptor-related protein 1 mediates uptake of amyloid beta peptides in an in vitro model of the blood-brain barrier cells.
18834984 2009 Insulin stimulates hepatic low density lipoprotein receptor-related protein 1 (LRP1) to increase postprandial lipoprotein clearance.
18706476 2008 Genetic association between low-density lipoprotein receptor-related protein gene polymorphisms and Alzheimer's disease in Chinese Han population.
18685438 2008 Interaction of coagulation factor VIII with members of the low-density lipoprotein receptor family follows common mechanism and involves consensus residues within the A2 binding site 484-509.
18683150 2008 [Association of the low density lipoprotein receptor-related protein gene 766C/T polymorphism with Alzheimer's disease in Xinjiang Uygurs and Hans].
18653767 2008 Thrombospondin 1 binding to calreticulin-LRP1 signals resistance to anoikis.
18648652 2008 Binding of alpha2ML1 to the low density lipoprotein receptor-related protein 1 (LRP1) reveals a new role for LRP1 in the human epidermis.
18635818 2008 Effects of six APOA5 variants, identified in patients with severe hypertriglyceridemia, on in vitro lipoprotein lipase activity and receptor binding.
18489712 2008 Involvement of the low-density lipoprotein receptor-related protein in the transcytosis of the brain delivery vector angiopep-2.
18381291 2008 Structural and functional consequences of tyrosine phosphorylation in the LRP1 cytoplasmic domain.
18373737 2008 C-terminal 37 residues of LRP promote the amyloidogenic processing of APP independent of FE65.
18321860 2008 The functional role of the second NPXY motif of the LRP1 beta-chain in tissue-type plasminogen activator-mediated activation of N-methyl-D-aspartate receptors.
18317248 Polymorphisms of APOE and LRP genes in Brazilian individuals with Alzheimer disease.
18288927 2008 Functional role of lipoprotein receptors in Alzheimer's disease.
18281370 2008 Angiotensin II upregulates LDL receptor-related protein (LRP1) expression in the vascular wall: a new pro-atherogenic mechanism of hypertension.
18277139 2008 The binding sites for the very low density lipoprotein receptor and low-density lipoprotein receptor-related protein are shared within coagulation factor VIII.
18231792 2008 Expression of heat shock protein receptors on fibroblast-like synovial cells derived from rheumatoid arthritis-affected joints.
18194421 2008 A unique function for LRP-1: a component of a two-receptor system mediating specific endocytosis of plasma-derived factor V by megakaryocytes.
18166789 2008 Factor VIII bypasses CD91/LRP for endocytosis by dendritic cells leading to T-cell activation.
18156630 2008 Perindoprilat modulates the activity of lipoprotein receptor-related protein in human mesangial cells.
18037995 2007 Tissue-type plasminogen activator promotes murine myofibroblast activation through LDL receptor-related protein 1-mediated integrin signaling.
17974965 2007 Protein kinase C-alpha-mediated regulation of low-density lipoprotein receptor related protein and urokinase increases astrocytoma invasion.
17942912 2007 The low-density lipoprotein receptor-related protein regulates cancer cell survival and metastasis development.
17908054 2008 Mutational analysis of the FXNPXY motif within LDL receptor-related protein 1 (LRP1) reveals the functional importance of the tyrosine residues in cell growth regulation and signal transduction.
17897319 2007 Integral and associated lysosomal membrane proteins.
17889283 2008 Low density lipoprotein receptor-related protein polymorphisms are not risk factors for venous thromboembolism.
17711877 2007 Cell-surface transglutaminase undergoes internalization and lysosomal degradation: an essential role for LRP1.
17709443 2007 LDL-receptor mRNA expression in men is downregulated within an hour of an acute fat load and is influenced by genetic polymorphism.
17694066 2007 Clearance of amyloid-beta by circulating lipoprotein receptors.
17620659 2007 Adipocyte differentiation-related protein is induced by LRP1-mediated aggregated LDL internalization in human vascular smooth muscle cells and macrophages.
17570828 2007 Plasminogen-dependent internalization of soluble melanotransferrin involves the low-density lipoprotein receptor-related protein and annexin II.
17452356 2007 Non-EST-based prediction of novel alternatively spliced cassette exons with cell signaling function in Caenorhabditis elegans and human.
17326667 2007 Apolipoprotein A-V interaction with members of the low density lipoprotein receptor gene family.
17203175 2007 The expression of low density lipoprotein receptor-related protein in colorectal carcinoma.
17155964 2007 Low-density lipoprotein receptor-related protein 1 polymorphism 663 C > T affects clotting factor VIII activity and increases the risk of venous thromboembolism.
17124247 2007 Identification of the ligands of protein interaction domains through a functional approach.
17012232 2006 Apolipoprotein E and low density lipoprotein receptor-related protein facilitate intraneuronal Abeta42 accumulation in amyloid model mice.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16956829 2006 Contribution of low density lipoprotein receptor-related protein genotypes to coagulation factor VIII levels in thrombotic women.
16938309 2006 Binding site structure of one LRP-RAP complex: implications for a common ligand-receptor binding motif.
16929535 2006 IAP family protein expression correlates with poor outcome of multiple myeloma patients in association with chemotherapy-induced overexpression of multidrug resistance genes.
16839343 2006 Proteolytic cleavage of factor VIII heavy chain is required to expose the binding-site for low-density lipoprotein receptor-related protein within the A2 domain.
16821592 Association between single nucleotide polymorphisms of drug resistance-associated genes and response to chemotherapy in advanced ovarian cancer.
16807059 2006 Human thyroid carcinoma cell invasion is controlled by the low density lipoprotein receptor-related protein-mediated clearance of urokinase plasminogen activator.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16697011 2006 Sterol regulatory element-binding protein-2 negatively regulates low density lipoprotein receptor-related protein transcription.
16606588 2006 [Meta-analysis of the association of the LRP C766T polymorphism with the risk of Alzheimer's disease].
16567404 2006 Loss of core fucosylation of low-density lipoprotein receptor-related protein-1 impairs its function, leading to the upregulation of serum levels of insulin-like growth factor-binding protein 3 in Fut8-/- mice.
16541075 2006 The finished DNA sequence of human chromosome 12.
16459332 2006 The urokinase/PAI-2 complex: a new high affinity ligand for the endocytosis receptor low density lipoprotein receptor-related protein.
16407289 2006 Regulation of the composition of the extracellular matrix by low density lipoprotein receptor-related protein-1: activities based on regulation of mRNA expression.
16402284 2006 Longitudinal memory performance during normal aging: twin association models of APOE and other Alzheimer candidate genes.
16362633 2006 Association study of polymorphisms in LRP1, tau and 5-HTT genes and Alzheimer's disease in a sample of Colombian patients.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
16328515 2006 A 3'-UTR polymorphism in the oxidized LDL receptor 1 gene increases Abeta40 load as cerebral amyloid angiopathy in Alzheimer's disease.
16175004 2005 Low-density lipoprotein receptor-related protein polymorphisms in patients with elevated factor VIII coagulant activity and venous thrombosis.
16167883 2005 Immune function of C1q and its modulators CD91 and CD93.
16102056 2005 Beyond endocytosis: LRP function in cell migration, proliferation and vascular permeability.
16088940 2005 TGF-beta control of cell proliferation.
16040006 2005 Association study of the A2M and LRP1 Genes with Alzheimer disease in the Han Chinese.
15944146 2005 Platelet-derived growth factor receptor-beta (PDGFR-beta) activation promotes its association with the low density lipoprotein receptor-related protein (LRP). Evidence for co-receptor function.
15925094 2005 Association study and meta-analysis of low-density lipoprotein receptor related protein in Alzheimer's disease.
15863833 2005 The apoE isoform binding properties of the VLDL receptor reveal marked differences from LRP and the LDL receptor.
15800028 2005 Expression of the common heat-shock protein receptor CD91 is increased on monocytes of exposed yet HIV-1-seronegative subjects.
15772078 2005 Sequences from the low density lipoprotein receptor-related protein (LRP) cytoplasmic domain enhance amyloid beta protein production via the beta-secretase pathway without altering amyloid precursor protein/LRP nuclear signaling.
15769472 2005 Functions of sorting nexin 17 domains and recognition motif for P-selectin trafficking.
15749709 2005 The low density lipoprotein receptor-related protein (LRP) is a novel beta-secretase (BACE1) substrate.
15705932 2005 LDL receptor-related protein and the vascular wall: implications for atherothrombosis.
15705569 2005 Rapid endocytosis of the low density lipoprotein receptor-related protein modulates cell surface distribution and processing of the beta-amyloid precursor protein.
15647823 2005 Expression of LRP1 by human osteoblasts: a mechanism for the delivery of lipoproteins and vitamin K1 to bone.
15634227 2005 Genetic-morphologic association study: association between the low density lipoprotein-receptor related protein (LRP) and cerebral amyloid angiopathy.
15591119 2005 Endothelial expression of E-selectin is induced by the platelet-specific chemokine platelet factor 4 through LRP in an NF-kappaB-dependent manner.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15328156 2005 LDL-receptor-related protein regulates beta2-integrin-mediated leukocyte adhesion.
15294142 2004 LRP/amyloid beta-peptide interaction mediates differential brain efflux of Abeta isoforms.
15288502 2004 Genetic and functional characteristics of the human in vivo LRP1/A2MR receptor suggested as a risk marker for Alzheimer's disease and other complex (degenerative) diseases.
15272003 2004 Serine and threonine phosphorylation of the low density lipoprotein receptor-related protein by protein kinase Calpha regulates endocytosis and association with adaptor molecules.
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15226301 2004 Identification and characterization of the acidic pH binding sites for growth regulatory ligands of low density lipoprotein receptor-related protein-1.
15135046 2004 Low-density lipoprotein receptor-related protein interacts with MafB, a regulator of hindbrain development.
15131125 2004 Mutants of plasminogen activator inhibitor-1 designed to inhibit neutrophil elastase and cathepsin G are more effective in vivo than their endogenous inhibitors.
15048651 2004 Regional European differences in allele and genotype frequencies of low density lipoprotein receptor-related protein 1 polymorphism in Alzheimer's disease.
15044004 2004 LRP-1/TbetaR-V mediates TGF-beta1-induced growth inhibition in CHO cells.
15001579 2004 The low density lipoprotein receptor-related protein is a motogenic receptor for plasminogen activator inhibitor-1.
14991768 2004 Internalization but not binding of thrombospondin-1 to low density lipoprotein receptor-related protein-1 requires heparan sulfate proteoglycans.
14980518 2004 The low-density lipoprotein receptor-related protein associates with calnexin, calreticulin, and protein disulfide isomerase in receptor-associated-protein-deficient fibroblasts.
14739301 2004 The low density lipoprotein receptor-1, LRP1, interacts with the human frizzled-1 (HFz1) and down-regulates the canonical Wnt signaling pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14699139 2004 Low density lipoprotein receptor-related protein-1 promotes beta1 integrin maturation and transport to the cell surface.
14645246 2004 The low density lipoprotein receptor-related protein LRP is regulated by membrane type-1 matrix metalloproteinase (MT1-MMP) proteolysis in malignant cells.
14597676 2003 Cellular growth inhibition by IGFBP-3 and TGF-beta1 requires LRP-1.
14593097 2004 Localization of low density lipoprotein receptor-related protein 1 to caveolae in 3T3-L1 adipocytes in response to insulin treatment.
14585398 2003 Low density lipoprotein receptor-related protein (LRP) is a heparin-dependent adhesion receptor for connective tissue growth factor (CTGF) in rat activated hepatic stellate cells.
12960961 2003 Lipoprotein receptor-mediated induction of matrix metalloproteinase by tissue plasminogen activator.
12888553 2003 The intracellular domain of the low density lipoprotein receptor-related protein modulates transactivation mediated by amyloid precursor protein and Fe65.
12857755 2003 Apolipoprotein E binding to low density lipoprotein receptor-related protein-1 inhibits cell migration via activation of cAMP-dependent protein kinase A.
12821648 2003 Low density lipoprotein receptor-related protein is a calreticulin coreceptor that signals focal adhesion disassembly.
12807892 2003 Dimers of beta 2-glycoprotein I increase platelet deposition to collagen via interaction with phospholipids and the apolipoprotein E receptor 2'.
12793904 2003 C766T low-density lipoprotein receptor-related protein 1 (LRP1) gene polymorphism and susceptibility to breast cancer.
12789267 2003 v-Src induces Shc binding to tyrosine 63 in the cytoplasmic domain of the LDL receptor-related protein 1.
12750160 2003 Disease-associated dendritic cells respond to disease-specific antigens through the common heat shock protein receptor.
12732394 2003 Influence of exonic polymorphisms in the gene for LDL receptor-related protein (LRP) on risk of coronary artery disease.
12713657 2003 LDL receptor-related proteins in neurodevelopment.
12672816 2003 Low density lipoprotein receptor-related protein (LRP) is required for lactoferrin-enhanced collagen gel contractile activity of human fibroblasts.
12637503 2003 Allosteric modulation of ligand binding to low density lipoprotein receptor-related protein by the receptor-associated protein requires critical lysine residues within its carboxyl-terminal domain.
12555245 2003 Association of the 3' UTR transcription factor LBP-1c/CP2/LSF polymorphism with late-onset Alzheimer's disease.
12531796 2003 The heat-shock protein receptor CD91 is up-regulated in monocytes of HIV-1-infected "true" long-term nonprogressors.
12522212 2003 Residues Phe342-Asn346 of activated coagulation factor IX contribute to the interaction with low density lipoprotein receptor-related protein.
12522143 2003 Low density lipoprotein receptor-related protein and factor IXa share structural requirements for binding to the A3 domain of coagulation factor VIII.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12473559 2002 Low-density lipoprotein upregulates low-density lipoprotein receptor-related protein expression in vascular smooth muscle cells: possible involvement of sterol regulatory element binding protein-2-dependent mechanism.
12417024 2002 Cellular catabolism of lipid poor apolipoprotein E via cell surface LDL receptor-related protein.
12412500 2002 [Properties and expression of the human activated alpha2-macroglobulin receptor].
12402342 2002 The LDL receptor-related protein (LRP1/A2MR) and coronary atherosclerosis--novel genomic variants and functional consequences.
12394648 2002 Variation in the lipoprotein receptor-related protein, alpha2-macroglobulin and lipoprotein receptor-associated protein genes in relation to plasma lipid levels and risk of early myocardial infarction.
12393177 2002 Expression and regulation by insulin of low-density lipoprotein receptor-related protein mRNA in human skeletal muscle.
12212791 The role of the low-density lipoprotein receptor-related protein (LRP1) in Alzheimer's A beta generation: development of a cell-based model system.
12194978 2002 The role of Grp 78 in alpha 2-macroglobulin-induced signal transduction. Evidence from RNA interference that the low density lipoprotein receptor-related protein is associated with, but not necessary for, GRP 78-mediated signal transduction.
12169628 2002 The PX-domain protein SNX17 interacts with members of the LDL receptor family and modulates endocytosis of the LDL receptor.
12069755 2002 Phosphorylation of LRP1: regulation of transport and signal transduction.
11992244 2002 Recombinant von Willebrand factor-insight into structure and function through infusion studies in animals with severe von Willebrand disease.
11931574 2002 The relationship among apolipoprotein(a) polymorphisms, the low-density lipoprotein receptor-related protein, and the very low density lipoprotein receptor genes, and plasma lipoprotein(A) concentration in the Czech population.
11907044 2002 Proteolytic processing of low density lipoprotein receptor-related protein mediates regulated release of its intracellular domain.
11867643 2002 The low density lipoprotein receptor-related protein mediates fibronectin catabolism and inhibits fibronectin accumulation on cell surfaces.
11861214 2002 An integrated view of the roles and mechanisms of heat shock protein gp96-peptide complex in eliciting immune response.
11854294 2002 Platelet-derived growth factor (PDGF)-induced tyrosine phosphorylation of the low density lipoprotein receptor-related protein (LRP). Evidence for integrated co-receptor function betwenn LRP and the PDGF.
11823454 2002 Distinct binding sites in the structure of alpha 2-macroglobulin mediate the interaction with beta-amyloid peptide and growth factors.
11735395 2001 Calcium coordination and pH dependence of the calcium affinity of ligand-binding repeat CR7 from the LRP. Comparison with related domains from the LRP and the LDL receptor.
11729193 2002 Interaction of CED-6/GULP, an adapter protein involved in engulfment of apoptotic cells with CED-1 and CD91/low density lipoprotein receptor-related protein (LRP).
11720768 2001 Case-control study and meta-analysis of low density lipoprotein receptor-related protein gene exon 3 polymorphism in Alzheimer's disease.
11705989 2002 The alpha -chains of C4b-binding protein mediate complex formation with low density lipoprotein receptor-related protein.
11600564 2001 Genetic diagnosis of familial hypercholesterolemia in a South European outbreed population: influence of low-density lipoprotein (LDL) receptor gene mutations on treatment response to simvastatin in total, LDL, and high-density lipoprotein cholesterol.
11560994 2001 C1q and mannose binding lectin engagement of cell surface calreticulin and CD91 initiates macropinocytosis and uptake of apoptotic cells.
11479307 2001 Low density lipoprotein receptor-related protein is required for macrophage-mediated oxidation of low density lipoprotein by 12/15-lipoxygenase.
11436125 2001 Lack of replication of association findings in complex disease: an analysis of 15 polymorphisms in prior candidate genes for sporadic Alzheimer's disease.
11421580 2001 Role of apolipoprotein E receptors in regulating the differential in vivo neurotrophic effects of apolipoprotein E.
11359936 2001 Direct binding of occupied urokinase receptor (uPAR) to LDL receptor-related protein is required for endocytosis of uPAR and regulation of cell surface urokinase activity.
11279011 2001 The low density lipoprotein receptor-related protein modulates levels of matrix metalloproteinase 9 (MMP-9) by mediating its cellular catabolism.
11248808 2000 CD91: a receptor for heat shock protein gp96.
11158305 2001 Identification of a major cyclic AMP-dependent protein kinase A phosphorylation site within the cytoplasmic tail of the low-density lipoprotein receptor-related protein: implication for receptor-mediated endocytosis.
11100124 2000 Uptake of HIV-1 tat protein mediated by low-density lipoprotein receptor-related protein disrupts the neuronal metabolic balance of the receptor ligands.
11076057 2000 Low density lipoprotein receptor-related protein gene polymorphisms and risk for late-onset Alzheimer's disease in a Japanese population.
11006321 2000 Differential expression of the alpha(2)-macroglobulin receptor and the receptor associated protein in normal human endometrium and endometrial carcinoma.
10880251 2000 Involvement of alpha-2-macroglobulin receptor in clearance of interleukin 8-alpha-2-macroglobulin complexes by human alveolar macrophages.
10827173 2000 Interactions of the low density lipoprotein receptor gene family with cytosolic adaptor and scaffold proteins suggest diverse biological functions in cellular communication and signal transduction.
10772929 2000 LDL receptor-related protein as a component of the midkine receptor.
10747918 2000 The YXXL motif, but not the two NPXY motifs, serves as the dominant endocytosis signal for low density lipoprotein receptor-related protein.
10652313 2000 NMR solution structure of complement-like repeat CR3 from the low density lipoprotein receptor-related protein. Evidence for specific binding to the receptor binding domain of human alpha(2)-macroglobulin.
10632583 2000 Role of tissue plasminogen activator receptor LRP in hippocampal long-term potentiation.
10608878 1999 Metabolism of activated complement component C3 is mediated by the low density lipoprotein receptor-related protein/alpha(2)-macroglobulin receptor.
10514495 1999 Collagenase-3 binds to a specific receptor and requires the low density lipoprotein receptor-related protein for internalization.
10471328 1999 Characterization of the soluble form of the low density lipoprotein receptor-related protein (LRP).
10318830 1999 NMR solution structure of complement-like repeat CR8 from the low density lipoprotein receptor-related protein.
9837937 1998 Interaction of cytosolic adaptor proteins with neuronal apolipoprotein E receptors and the amyloid precursor protein.
9820815 1998 Low-density-lipoprotein-receptor-related protein (LRP) interacts with a GTP-binding protein.
9804823 1998 CD19 is linked to the integrin-associated tetraspans CD9, CD81, and CD82.
9782078 1998 Strategy to sequence the 89 exons of the human LRP1 gene coding for the lipoprotein receptor related protein: identification of one expressed mutation among 48 polymorphisms.
9295345 1997 Soluble low density lipoprotein receptor-related protein (LRP) circulates in human plasma.
9252371 1997 The type V transforming growth factor beta receptor is the putative insulin-like growth factor-binding protein 3 receptor.
9051770 1996 Immunocytochemical demonstration of alpha 2-M-R/LRP on Müller (glial) cells isolated from rabbit and human retina.
9045716 1997 Low density lipoprotein receptor-related protein modulates the expression of tissue-type plasminogen activator in human colon fibroblasts.
9045712 1997 Cellular internalization and degradation of thrombospondin-1 is mediated by the amino-terminal heparin binding domain (HBD). High affinity interaction of dimeric HBD with the low density lipoprotein receptor-related protein.
8806749 1996 Characterization of alpha 2-macroglobulin binding to human trabecular meshwork cells: presence of the alpha 2-macroglobulin signaling receptor.
8703036 1996 Receptor-associated protein is a folding chaperone for low density lipoprotein receptor-related protein.
8626514 1996 Plasminogen activator inhibitor-1 and vitronectin promote the cellular clearance of thrombin by low density lipoprotein receptor-related proteins 1 and 2.
8546712 1996 The low-density-lipoprotein receptor-related protein (LRP) is processed by furin in vivo and in vitro.
8307199 1994 Expression of alpha 2-macroglobulin receptor/low density lipoprotein receptor-related protein is increased in reactive and neoplastic glial cells.
7989348 1994 A carboxyl-terminal fragment of lipoprotein lipase binds to the low density lipoprotein receptor-related protein and inhibits lipase-mediated uptake of lipoprotein in cells.
7961982 1994 Subcellular localization and endocytic function of low density lipoprotein receptor-related protein in human glioblastoma cells.
7721852 1995 The cellular internalization and degradation of hepatic lipase is mediated by low density lipoprotein receptor-related protein and requires cell surface proteoglycans.
7543026 1995 LDL receptor-related protein, a multifunctional ApoE receptor, binds secreted beta-amyloid precursor protein and mediates its degradation.
7534747 1994 Structure of the gene (LRP1) coding for the human alpha 2-macroglobulin receptor lipoprotein receptor-related protein.
7510694 1994 The carboxyl-terminal domain of lipoprotein lipase binds to the low density lipoprotein receptor-related protein/alpha 2-macroglobulin receptor (LRP) and mediates binding of normal very low density lipoproteins to LRP.
7508685 1994 Expression of alpha 2-macroglobulin receptor/low density lipoprotein receptor-related protein and the 39-kd receptor-associated protein in human trophoblasts.
3266596 1988 Surface location and high affinity for calcium of a 500-kd liver membrane protein closely related to the LDL-receptor suggest a physiological role as lipoprotein receptor.
2779654 1989 The LDL-receptor-related protein, LRP, is an apolipoprotein E-binding protein.
2597675 1989 Structure of the low-density lipoprotein receptor-related protein (LRP) promoter.
2548950 1989 The gene for the human putative apoE receptor is on chromosome 12 in the segment q13-14.
2112085 1990 Proteolytic processing of the 600 kd low density lipoprotein receptor-related protein (LRP) occurs in a trans-Golgi compartment.
1718973 1991 39-kDa protein modulates binding of ligands to low density lipoprotein receptor-related protein/alpha 2-macroglobulin receptor.
1702392 1990 Evidence that the newly cloned low-density-lipoprotein receptor related protein (LRP) is the alpha 2-macroglobulin receptor.
1698775 1990 Sequence identity between the alpha 2-macroglobulin receptor and low density lipoprotein receptor-related protein suggests that this molecule is a multifunctional receptor.
1618748 1992 The alpha 2-macroglobulin receptor/low density lipoprotein receptor-related protein binds and internalizes Pseudomonas exotoxin A.
1502153 1992 Complexes of tissue-type plasminogen activator and its serpin inhibitor plasminogen-activator inhibitor type 1 are internalized by means of the low density lipoprotein receptor-related protein/alpha 2-macroglobulin receptor.
1464627 1992 Low density lipoprotein receptor-related protein and gp330 bind similar ligands, including plasminogen activator-inhibitor complexes and lactoferrin, an inhibitor of chylomicron remnant clearance.
1423505 1992 Distribution of the alpha 2-macroglobulin receptor/low density lipoprotein receptor-related protein in human tissues.
1377168 1992 Assignment of the gene coding for the alpha 2-macroglobulin receptor to mouse chromosome 15 and to human chromosome 12q13-q14 by isotopic and nonisotopic in situ hybridization.
1374383 1992 A novel mechanism for controlling the activity of alpha 2-macroglobulin receptor/low density lipoprotein receptor-related protein. Multiple regulatory sites for 39-kDa receptor-associated protein.
1281473 1992 The low density lipoprotein receptor-related protein/alpha 2-macroglobulin receptor binds and mediates catabolism of bovine milk lipoprotein lipase.