Property Summary

NCBI Gene PubMed Count 24
PubMed Score 14.88
PubTator Score 20.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
osteosarcoma 2.291 1.1e-02
posterior fossa group B ependymoma 2.900 2.1e-11
glioblastoma 2.000 1.4e-04
sonic hedgehog group medulloblastoma 1.700 1.6e-05
atypical teratoid / rhabdoid tumor 1.300 6.7e-04
medulloblastoma, large-cell 2.200 2.2e-02
primitive neuroectodermal tumor 1.100 3.9e-02
non-small cell lung carcinoma 1.500 3.4e-19
interstitial cystitis -1.100 3.7e-03
lung adenocarcinoma 1.400 1.2e-04
pediatric high grade glioma 1.900 6.7e-06
nasopharyngeal carcinoma 1.100 1.5e-02
Breast cancer -1.800 1.8e-05
invasive ductal carcinoma -1.300 4.3e-02
ovarian cancer -1.200 2.3e-02

 GO Process (1)

Gene RIF (17)

PMID Text
26390694 LRIG3 plays an important role in Hela229 cell proliferation, apoptosis, and invasiveness.
25708990 LRIG3 functions as a tumor suppressor by attenuating EGFR signaling pathway.
24998916 The results on expression of other tumor markers suggest that LRIG3 is influenced by or influences a pattern of tumor markers in cancer and precancerous cells.
23723069 Data indicate that Lrig3 opposes Lrig1 negative regulatory action and enhances ErbB receptors ERBB2, ERBB3 and ERBB4 stability.
23392718 In conclusion, the over-expression of LRIG3 could influence the cell cycle and invasion, inhibit proliferation and induce apoptosis in the three bladder cancer cell lines.
23165628 High LRIG3 expression is associated with cervical adenocarcinoma progression.
21505989 Silencing LRIG3 inhibited the proliferation and promoted the apoptosis of bladder cancer T24 cells.
20446891 Observational study of gene-disease association. (HuGE Navigator)
20445134 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19448407 Down-regulating LRIG3 gene expression can improve the proliferation of glioma GL15 cells.
19224171 siRNA targeting LRIG3 gene shows a dramatic inhibitory effect on RNA transcription and protein expression, then promotes the proliferation and suppresses apoptosis of GL15 cells.
19216216 the expression of LRIG1-3 was evaluated in 51 human ependymomas and was found to be more highly expressed in supratentorial than in infratentorial ependymomas
19200647 LRIG3 may be involved in the regulation of EGF receptor signaling, and serve as a tumor suppressor gene in the pathogenesis of glioma.
18037903 LRIG proteins may have a role in epidermal homeostasis and psoriasis
17393120 Down-regulation of LRIG3 in HP75 pituitary adenoma is reported.
16532360 These results indicate that expression and sub-cellular localization of LRIG1-3 might be of importance in the pathogenesis and prognosis of astrocytic tumors.

AA Sequence

MSAPSLRARAAGLGLLLCAVLGRAGRSDSGGRGELGQPSGVAAERPCPTTCRCLGDLLDCSRKRLARLPE      1 - 70
PLPSWVARLDLSHNRLSFIKASSMSHLQSLREVKLNNNELETIPNLGPVSANITLLSLAGNRIVEILPEH     71 - 140
LKEFQSLETLDLSSNNISELQTAFPALQLKYLYLNSNRVTSMEPGYFDNLANTLLVLKLNRNRISAIPPK    141 - 210
MFKLPQLQHLELNRNKIKNVDGLTFQGLGALKSLKMQRNGVTKLMDGAFWGLSNMEILQLDHNNLTEITK    211 - 280
GWLYGLLMLQELHLSQNAINRISPDAWEFCQKLSELDLTFNHLSRLDDSSFLGLSLLNTLHIGNNRVSYI    281 - 350
ADCAFRGLSSLKTLDLKNNEISWTIEDMNGAFSGLDKLRRLILQGNRIRSITKKAFTGLDALEHLDLSDN    351 - 420
AIMSLQGNAFSQMKKLQQLHLNTSSLLCDCQLKWLPQWVAENNFQSFVNASCAHPQLLKGRSIFAVSPDG    421 - 490
FVCDDFPKPQITVQPETQSAIKGSNLSFICSAASSSDSPMTFAWKKDNELLHDAEMENYAHLRAQGGEVM    491 - 560
EYTTILRLREVEFASEGKYQCVISNHFGSSYSVKAKLTVNMLPSFTKTPMDLTIRAGAMARLECAAVGHP    561 - 630
APQIAWQKDGGTDFPAARERRMHVMPEDDVFFIVDVKIEDIGVYSCTAQNSAGSISANATLTVLETPSFL    631 - 700
RPLLDRTVTKGETAVLQCIAGGSPPPKLNWTKDDSPLVVTERHFFAAGNQLLIIVDSDVSDAGKYTCEMS    701 - 770
NTLGTERGNVRLSVIPTPTCDSPQMTAPSLDDDGWATVGVVIIAVVCCVVGTSLVWVVIIYHTRRRNEDC    771 - 840
SITNTDETNLPADIPSYLSSQGTLADRQDGYVSSESGSHHQFVTSSGAGFFLPQHDSSGTCHIDNSSEAD    841 - 910
VEAATDLFLCPFLGSTGPMYLKGNVYGSDPFETYHTGCSPDPRTVLMDHYEPSYIKKKECYPCSHPSEES    911 - 980
CERSFSNISWPSHVRKLLNTSYSHNEGPGMKNLCLNKSSLDFSANPEPASVASSNSFMGTFGKALRRPHL    981 - 1050
DAYSSFGQPSDCQPRAFYLKAHSSPDLDSGSEEDGKERTDFQEENHICTFKQTLENYRTPNFQSYDLDT    1051 - 1119
//

Text Mined References (24)

PMID Year Title
26390694 2015 Expression and significance of LRIG3 in human cervical squamous cell carcinoma.
25708990 2015 LRIG3 modulates proliferation, apoptosis and invasion of glioblastoma cells as a potent tumor suppressor.
24998916 2014 Immunohistochemical LRIG3 expression in cervical intraepithelial neoplasia and invasive squamous cell cervical cancer: association with expression of tumor markers, hormones, high-risk HPV-infection, smoking and patient outcome.
24823311 2014 Genome-wide association study of plasma N6 polyunsaturated fatty acids within the cohorts for heart and aging research in genomic epidemiology consortium.
23723069 2013 Leucine-rich repeat and immunoglobulin domain-containing protein-1 (Lrig1) negative regulatory action toward ErbB receptor tyrosine kinases is opposed by leucine-rich repeat and immunoglobulin domain-containing protein 3 (Lrig3).
23392718 2013 Over-expression of LRIG3 suppresses growth and invasion of bladder cancer cells.
23165628 2013 Expression of LRIG1 and LRIG3 correlates with human papillomavirus status and patient survival in cervical adenocarcinoma.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
21505989 2011 Effect of silencing LRIG3 gene on the proliferation and apoptosis of bladder cancer T24 cells.
20446891 2010 A comprehensive study of the association between the EGFR and ERBB2 genes and glioma risk.
20445134 2010 Association of genome-wide variation with the risk of incident heart failure in adults of European and African ancestry: a prospective meta-analysis from the cohorts for heart and aging research in genomic epidemiology (CHARGE) consortium.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19448407 2009 Effect of RNAi-mediated LRIG3 gene silencing on proliferation of glioma GL15 cells and expression of PCNA and Ki-67.
19224171 2009 Effects of RNAi-mediated gene silencing of LRIG3 expression on cell cycle and survival of glioma cells.
19216216 Expression of leucine-rich repeats and immunoglobulin-like domains (LRIG) proteins in human ependymoma relates to tumor location, WHO grade, and patient age.
19200647 2009 Inhibition of LRIG3 gene expression via RNA interference modulates the proliferation, cell cycle, cell apoptosis, adhesion and invasion of glioblastoma cell (GL15).
18037903 2008 Redistribution of LRIG proteins in psoriasis.
17393120 2007 Down-regulation of leucine-rich repeats and immunoglobulin-like domain proteins (LRIG1-3) in HP75 pituitary adenoma cell line.
16532360 2006 Perinuclear leucine-rich repeats and immunoglobulin-like domain proteins (LRIG1-3) as prognostic indicators in astrocytic tumors.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15203213 2004 The LRIG gene family has three vertebrate paralogs widely expressed in human and mouse tissues and a homolog in Ascidiacea.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.